RAR beta/NR1B2 Antibody

Western Blot: RAR beta/NR1B2 Antibody [H00005915-D01P] - Analysis of RARB expression in transfected 293T cell line by RARB polyclonal antibody.Lane 1: RARB transfected lysate(50.30 KDa).Lane 2: Non-transfected lysate.

Product Discontinued

RAR beta/NR1B2 Antibody Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: RARB (NP_000956.2, 1 a.a. - 448 a.a.) full-length human protein. MFDCMDVLSVSPGQILDFYTASPSSCMLQEKALKACFSGLTQTEWQHRHTAQSIETQSTSSEELVPSPPSPLPPPRVYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMIYTCHRDKNCVINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKETSKQECTESYEMTAELDDLTEKIRKAHQETFPSLCQLGKYTTNSSADHRVRLDLGLWDKFSELATKCIIKIVEFAKRLPGFTGLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFTFANQLLPLEMDDTETGLLSAICLICGDRQDLEEPTKVDKLQEPLLEALKIYIRKRRPSKPHMFPKILMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGHEPLTPSSSGNTAEHSPSISPSSVENSGVSQSPLVQ
• Specificity: Reacts with retinoic acid receptor, beta.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RARB
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot
• Application Notes: This antibody is reactive against transfected lysate in WB and as a detection antibody in ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RAR beta/NR1B2 Antibody

• beta polypeptide
• HAP
• HBV-activated protein
• NR1B2
• RAR beta
• RARB
• retinoic acid receptor, beta
• RRB2

Background

This gene encodes retinoic acid receptor beta, a member of the thyroid-steroid hormone receptor superfamily of nuclear transcriptional regulators. This receptor localizes to the cytoplasm and to subnuclear compartments. It binds retinoic acid, the biologically active form of vitamin A which mediates cellular signalling in embryonic morphogenesis, cell growth and differentiation. It is thought that this protein limits growth of many cell types by regulating gene expression. The gene was first identified in a hepatocellular carcinoma where it flanks a hepatitis B virus integration site. The gene expresses at least two transcript variants; one additional transcript has been described, but its full length nature has not been determined. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

FAQs for RAR beta/NR1B2 Antibody (H00005915-D01P). (Showing 1 - 1 of 1 FAQ).

1. I am planning to perform IHC staining of RARB on FFPE samples. I have found the reference "J Cutan Pathol 2009;36; 1141-1145" used an antibody from your company. Would you let me know any other references using the antibody for IHC staining of RARB?
   • Unfortunately we are not aware of any other publication wherein our Retinoic Acid Receptor beta antibodies were cited for their use in IHC application. From our sales records, it looks like the researcher used catalog number NB200-323 in the publication you mentioned. Retinoic Acid Receptor beta antibody NB200-323 is our best selling product among this category and it has also been cited for its use in WB application by Yang et al. in Am J Physiol Renal Physiol. 2008 Jun;294(6):F1433-40. We have at least 7 primary antibody products to Retinoic Acid Receptor beta that have been validated for IHC-P application.. We stand behind the quality of our products and offer 100% guarantee for the applications/species mentioned on the datasheets. We are always there to help if you come up with any difficulties and yes, we provide replacements/refunds after troubleshooting a problem, if you do not get your desired outcome! Therefore, please let us know if you have any specific questions or concerns on the IHC-P application of our Retinoic Acid Receptor beta antibodies. You may contact us at technical@novusbio.com.

Bioinformatics

• Gene Symbol: RARB
• Entrez:
  • 5915(Human)
• Uniprot:
  • NP_000956.2(Human)