Home » RANBP6 » RANBP6 Antibodies » RANBP6 Antibody - BSA Free

RANBP6 Antibody - BSA Free

 Submit a Review

Images

 
(
Enlarge)
Western Blot: RANBP6 Antibody [NBP2-88123] - Host: Rabbit. Target Name: RANBP6. Sample Tissue: Human LN18 Whole Cell lysates. Antibody Dilution: 1ug/ml
Western Blot: RANBP6 Antibody [NBP2-88123] - Host: Rabbit. Target Name: RANBP6. Sample Tissue: Human LN18 Whole Cell lysates. Antibody Dilution: 1ug/ml

Product Details

Summary
Product Discontinued
View other related RANBP6 Primary Antibodies

Order Details


    • Catalog Number
      NBP2-88123
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

RANBP6 Antibody - BSA Free Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human RANBP6. Peptide sequence: KFMQDASNVMQLLLKTQSDLNNMEDDDPQTSYMVSAWARMCKILGKDFQQ The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
RANBP6
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified

Alternate Names for RANBP6 Antibody - BSA Free

  • FLJ54311
  • RAN binding protein 6
  • ran-binding protein 6
  • RanBP6
  • Ran-GTP binding protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Ran Antibody
(8D1A6) - BSA Free
NBP2-61832
ELISA Ran Antibody (8D1A6) - BSA Free
Flow Cytometry Ran Antibody (8D1A6) - BSA Free
Immunocytochemistry/ Immunofluorescence Ran Antibody (8D1A6) - BSA Free
(1 Publication)
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
RanBP1 Antibody -
BSA Free
NB100-79814
Western Blot RanBP1 Antibody - BSA Free
Western Blot RanBP1 Antibody - BSA Free
(2 Reviews)
(3 Publications)
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, WB
RanBP2 Antibody
NB120-2938
Western Blot RanBP2 Antibody
Immunohistochemistry RanBP2 Antibody
Western Blot RanBP2 Antibody
(2 Publications)
Species: Bv, Hu, Mu
Applications: IHC,  IHC-P, WB
VASA Antibody
[Unconjugated]
AF2030
Western Blot VASA Antibody [Unconjugated]
Immunohistochemistry VASA Antibody [Unconjugated]
Immunohistochemistry VASA Antibody [Unconjugated]
(58 Publications)
Species: Hu
Applications: IHC, WB
RCC1 Antibody -
BSA Free
NBP1-85638
Immunocytochemistry/ Immunofluorescence RCC1 Antibody - BSA Free
Immunohistochemistry-Paraffin RCC1 Antibody - BSA Free
Immunohistochemistry-Paraffin RCC1 Antibody - BSA Free
(3 Publications)
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
RANBP9 Antibody
(4P10V6)
NBP3-15702
Immunohistochemistry-Paraffin RANBP9 Antibody (4P10V6)
Western Blot RANBP9 Antibody (4P10V6)
Immunohistochemistry-Paraffin RANBP9 Antibody (4P10V6)
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
RanGAP1 Antibody
(OTI1B4)
NBP2-02623
Flow Cytometry RanGAP1 Antibody (OTI1B4)
Flow Cytometry RanGAP1 Antibody (OTI1B4)
Flow Cytometry RanGAP1 Antibody (OTI1B4)
(1 Publication)
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
AGFG2 Antibody -
BSA Free
NBP1-83213
Immunohistochemistry-Paraffin AGFG2 Antibody - BSA Free
Immunohistochemistry-Paraffin AGFG2 Antibody - BSA Free
Immunohistochemistry-Paraffin AGFG2 Antibody - BSA Free
Species: Hu
Applications: IHC,  IHC-P, WB
Nup153 Antibody
NB100-93329
Immunocytochemistry/ Immunofluorescence Nup153 Antibody
Western Blot Nup153 Antibody
Western Blot Nup153 Antibody
(2 Reviews)
(4 Publications)
Species: Hu
Applications: ICC/IF, IP, KO, WB
S100A10 Antibody
[Unconjugated]
AF2377
Western Blot S100A10 Antibody [Unconjugated]
Immunohistochemistry S100A10 Antibody [Unconjugated]
Simple Western S100A10 Antibody [Unconjugated]
(22 Publications)
Species: Mu
Applications: IHC, Simple Western, WB
EXOSC3 Antibody -
BSA Free
NBP2-22261
Western Blot EXOSC3 Antibody - BSA Free
Immunoprecipitation EXOSC3 Antibody - BSA Free
Western Blot EXOSC3 Antibody - BSA Free
(1 Review)
(2 Publications)
Species: Ch, Hu, Mu
Applications: IP, WB
RANBP6 Antibody -
BSA Free
NBP2-88123
RANBP6 Antibody - BSA Free
Species: Hu
Applications: WB

Publications for RANBP6 Antibody (NBP2-88123) (0)

There are no publications for RANBP6 Antibody (NBP2-88123).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RANBP6 Antibody (NBP2-88123) (0)

There are no reviews for RANBP6 Antibody (NBP2-88123). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RANBP6 Antibody (NBP2-88123) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RANBP6 Products

Blogs on RANBP6

There are no specific blogs for RANBP6, but you can read our latest blog posts.

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RANBP6 Antibody - BSA Free and receive a gift card or discount.


Bioinformatics

Gene Symbol RANBP6