RAMP3 Antibody - Azide and BSA Free

Western Blot: RAMP3 Antibody [H00010268-B01P] - Analysis of RAMP3 expression in transfected 293T cell line by RAMP3 polyclonal antibody. Lane 1: RAMP3 transfected lysate(16.50 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

RAMP3 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse RAMP3 Antibody - Azide and BSA Free (H00010268-B01P) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: RAMP3 (NP_005847.1, 1 a.a. - 148 a.a.) full-length human protein. METGALRRPQLLPLLLLLCGGCPRAGGCNETGMLERLPLCGKAFADMMGKVDVWKWCNLSEFIVYYESFTNCTEMEANVVGCYWPNPLAQGFITGIHRQFFSNCTVDRVHLEDPPDEVLIPLIVIPVVLTVAMAGLVVWRSKRTDTLL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: RAMP3
• Purity: Protein G purified

Applications/Dilutions

• Dilutions:
  • Western Blot
• Application Notes: This antibody is useful for Western Blot

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein G purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RAMP3 Antibody - Azide and BSA Free

• calcitonin receptor-like receptor activity modifying protein 3
• Calcitonin-receptor-like receptor activity-modifying protein 3
• CRLR activity-modifying protein 3
• RAMP3
• receptor (calcitonin) activity modifying protein 3
• receptor (G protein-coupled) activity modifying protein 3
• receptor activity modifying protein 3
• receptor activity-modifying protein 3
• receptor-activity-modifying protein 3

Background

The protein encoded by this gene is a member of the RAMP family of single-transmembrane-domain proteins, called receptor (calcitonin) activity modifying proteins (RAMPs). RAMPs are type I transmembrane proteins with an extracellular N terminus and a cytoplasmic C terminus. RAMPs are required to transport calcitonin-receptor-like receptor (CRLR) to the plasma membrane. CRLR, a receptor with seven transmembrane domains, can function as either a calcitonin-gene-related peptide (CGRP) receptor or an adrenomedullin receptor, depending on which members of the RAMP family are expressed. In the presence of this (RAMP3) protein, CRLR functions as an adrenomedullin receptor.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RAMP3
• Uniprot:
  • NP_005847.1(Human)