RALGDS Antibody (1A11)

Images

 
Sandwich ELISA: RALGDS Antibody (1A11) [H00005900-M01] - Detection limit for recombinant GST tagged RALGDS is approximately 0.1ng/ml as a capture antibody.
Proximity Ligation Assay: RALGDS Antibody (1A11) [H00005900-M01] - Analysis of protein-protein interactions between MAPK3 and RALGDS. HeLa cells were stained with anti-MAPK3 rabbit purified polyclonal 1:1200 and ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA, PLA
Clone
1A11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

RALGDS Antibody (1A11) Summary

Immunogen
RALGDS (AAH59362 793 a.a. - 902 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SLDVDNGNMYKSILVTSQDKAPAVIRKAMDKHNLEEEEPEDYELLQILSDDRKLKIPENANVFYAMNSTANYDFVLKKRTFTKGVKVKHGASSTLPRMKQKGLKIAKGIF
Specificity
RALGDS - ral guanine nucleotide dissociation stimulator
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
RALGDS
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Proximity Ligation Assay
Application Notes
Antibody reactivity against recombinant protein on ELISA. GST alone used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RALGDS Antibody (1A11)

  • ral guanine nucleotide dissociation stimulator
  • Ral guanine nucleotide exchange factor
  • RalGDS
  • RalGEFKIAA1308
  • RGDS
  • RGFFLJ20922

Background

Stimulates the dissociation of GDP from the Ras-related RalA and RalB GTPases which allows GTP binding and activation of the GTPases. Interacts and acts as an effector molecule for R-Ras, H-Ras, K-Ras, and Rap (from SwissProt).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
MAB4540
Species: Hu, Mu, Rt
Applications: WB, IHC
AF3204
Species: Hu, Mu, Rt
Applications: WB
NBP1-33415
Species: Hu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NBP2-20866
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P
NBP2-37384
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P
NB600-586
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-45745
Species: Hu
Applications: WB, IHC, IF
NBP2-22526
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-45923
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-68136
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
NBP2-46403
Species: Hu
Applications: IHC
NBP2-15071
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-46404
Species: Hu
Applications: IHC, IHC-P
NBP1-81858
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-33116
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00005900-M01
Species: Hu
Applications: ELISA, PLA

Publications for RALGDS Antibody (H00005900-M01) (0)

There are no publications for RALGDS Antibody (H00005900-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RALGDS Antibody (H00005900-M01) (0)

There are no reviews for RALGDS Antibody (H00005900-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for RALGDS Antibody (H00005900-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RALGDS Products

Bioinformatics Tool for RALGDS Antibody (H00005900-M01)

Discover related pathways, diseases and genes to RALGDS Antibody (H00005900-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RALGDS Antibody (H00005900-M01)

Discover more about diseases related to RALGDS Antibody (H00005900-M01).
 

Pathways for RALGDS Antibody (H00005900-M01)

View related products by pathway.

PTMs for RALGDS Antibody (H00005900-M01)

Learn more about PTMs related to RALGDS Antibody (H00005900-M01).
 

Research Areas for RALGDS Antibody (H00005900-M01)

Find related products by research area.

Blogs on RALGDS

There are no specific blogs for RALGDS, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RALGDS Antibody (1A11) and receive a gift card or discount.

Bioinformatics

Gene Symbol RALGDS
Entrez
OMIM
Uniprot