Rabphilin 3A Antibody

Images

 
Western Blot: Rabphilin 3A Antibody [NBP1-69184] - Sample Type: 1. Lamprey CNS (20ug) 2. Rat Brain Lysate (20ug) Primary Dilution: 1:1000 Secondary Antibody: Goat anti-Rabbit HRP Secondary Dilution: 1:4000 Image ...read more
Western Blot: Rabphilin 3A Antibody [NBP1-69184] - Rph3a Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:1562500 Positive Control: Mouse Muscle

Product Details

Summary
Reactivity Mu, RtSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Rabphilin 3A Antibody Summary

Immunogen
Synthetic peptides corresponding to Rph3a (rabphilin 3A) The peptide sequence was selected from the N terminal of Rph3a. Peptide sequence GAWFFKGFPKQVLPQPMPIKKTKPQQPAGEPATQEQPTPESRHPARAPAR.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RPH3A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against Rph3a and was validated on Western blot.
Theoretical MW
75 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Rabphilin 3A Antibody

  • Exophilin-1
  • KIAA0985exophilin-1
  • rabphilin 3A homolog (mouse)
  • rabphilin
  • rabphilin-3A

Background

RPH3A is a protein transport. RPH3A is probably involved with Ras-related protein Rab-3A in synaptic vesicle traffic and/or synaptic vesicle fusion. RPH3A could play a role in neurotransmitter release by regulating membrane flow in the nerve terminal.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-3335
Species: Hu, Mu, Rt, Ca
Applications: WB, Flow, ICC/IF, IP
NBP1-92335
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-80991
Species: Hu
Applications: IHC, IHC-P
NBP2-00795
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-91499
Species: Mu, Bv
Applications: WB, ICC/IF, IHC
AF7904
Species: Hu, Mu
Applications: WB
NB100-79810
Species: Hu, Mu
Applications: WB, ICC/IF, IP, PLA
H00005873-M02
Species: Hu
Applications: WB, ELISA, IHC-P, RNAi
AF8064
Species: Hu
Applications: WB, IHC, ICC
NBP1-32871
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB300-943
Species: Mu
Applications: WB, ICC/IF, IHC-P, PEP-ELISA
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1936
Species: Hu
Applications: WB, IP
NBP1-69184
Species: Mu, Rt
Applications: WB
NBP1-86176
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91991
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13930
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-69184
Species: Mu, Rt
Applications: WB

Publications for Rabphilin 3A Antibody (NBP1-69184) (0)

There are no publications for Rabphilin 3A Antibody (NBP1-69184).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Rabphilin 3A Antibody (NBP1-69184) (0)

There are no reviews for Rabphilin 3A Antibody (NBP1-69184). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Rabphilin 3A Antibody (NBP1-69184) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Rabphilin 3A Products

Bioinformatics Tool for Rabphilin 3A Antibody (NBP1-69184)

Discover related pathways, diseases and genes to Rabphilin 3A Antibody (NBP1-69184). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Rabphilin 3A Antibody (NBP1-69184)

Discover more about diseases related to Rabphilin 3A Antibody (NBP1-69184).
 

Pathways for Rabphilin 3A Antibody (NBP1-69184)

View related products by pathway.

Blogs on Rabphilin 3A

There are no specific blogs for Rabphilin 3A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Rabphilin 3A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RPH3A
Uniprot