Recombinant Human RAB40B Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human RAB40B Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-278 of Human RAB40B full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MSALGSPVRAYDFLLKFLLVGDSDVGKGEILASLQDGAAESPYGHPAGIDYKTTTILLDGRRVKLQLWDTSGQGRFCTIFRSYSRGAQGVILVYDIANRWSFDGIDRWIKEIDEHAPGVPKILVGNRLHLAFKRQVPTEQAQAYAERLGVTFFEVSPLCNFNITESFTELARIVLLRHGMDRLWRPSKVLSLQDLCCRAVVSCTPVHLVDKLPLPIALRSHLKSFSMANGLNARMMHGGSYSLTTSSTHKRSSLRKVKLVRPPQSPPKNCTRNSCKIS

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
RAB40B

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human RAB40B Protein

  • GTP-binding protein homologous to Saccharomyces cerevisiae SEC4
  • Protein Rar
  • RAB40B, member RAS oncogene family
  • RAR
  • ras-related protein Rab-40B
  • SEC4LFLJ42385
  • SOCS box-containing protein RAR

Background

The protein encoded by this gene has similarity to a yeast protein which suggests a role of the gene product in regulating secretory vesicles. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-322
Species: Hu, Mu, Rt
Applications: WB, IHC-Fr
NBP1-81776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-47314
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-86919
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-71770
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-07100
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB200-585
Species: Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
NBP2-20619
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
PP-H4537-00
Species: Hu
Applications: WB, IHC, IP, DirELISA
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP2-29942
Species: Hu
Applications: WB, Flow, IHC-P
NB100-58824
Species: Hu, Mu
Applications: WB, ChIP, IP, PLA
NB100-56530
Species: Hu
Applications: WB
MAB5526
Species: Hu, Mu
Applications: WB
NBP1-89544
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-59787
Species: Hu, Mu
Applications: WB, IB, ICC/IF, IHC, IHC-P, IP, PLA
H00010966-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for RAB40B Recombinant Protein (H00010966-P01) (0)

There are no publications for RAB40B Recombinant Protein (H00010966-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RAB40B Recombinant Protein (H00010966-P01) (0)

There are no reviews for RAB40B Recombinant Protein (H00010966-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RAB40B Recombinant Protein (H00010966-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RAB40B Products

Bioinformatics Tool for RAB40B Recombinant Protein (H00010966-P01)

Discover related pathways, diseases and genes to RAB40B Recombinant Protein (H00010966-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RAB40B Recombinant Protein (H00010966-P01)

Discover more about diseases related to RAB40B Recombinant Protein (H00010966-P01).
 

Pathways for RAB40B Recombinant Protein (H00010966-P01)

View related products by pathway.

Research Areas for RAB40B Recombinant Protein (H00010966-P01)

Find related products by research area.

Blogs on RAB40B

There are no specific blogs for RAB40B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

RAB40B Antibody
NBP1-58922

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human RAB40B Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RAB40B