RAB35 Antibody - BSA Free

Western Blot: RAB35 Antibody [NBP1-79484] - Human heart cell lysate.

Immunocytochemistry/Immunofluorescence: RAB35 Antibody [NBP1-79484] - Human dorsal root ganglion neurons. Dual ICC stain RAB35 in green, NF200 in red. Note axons are out of view, this is a Z-stack section. RAB35 antibody at 1:500. Strong plasma membrane binding which is consistent with tagged construct expression. Some non-specific binding in the nucleus/nucleolus which may improve with lowered antibody concentrations. Primary incubation overnight at 4C, secondary antibodies (Alexa 488 and 546) at room temperature. ICC/IF image submitted by a verified customer review.

Western Blot: RAB35 Antibody [NBP1-79484] - HeLa cells, HEK293T cells. Antibody at 1:500.

• Reactivity: Hu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

RAB35 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptide directed towards the middle region of human RAB35. Peptide sequence: GIQLFETSAKENVNVEEMFNCITELVLRAKKDNLAKQQQQQQNDVVKLTK The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RAB35
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot 1.0 ug/ml
• Application Notes: This RAB35 antibody is validated for ICC/IF from a verified customer review.
• Theoretical MW: 23 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for RAB35 Antibody - BSA Free

• GTP-binding protein RAY
• H-ray
• RAB1C
• RAB35, member RAS oncogene family
• ras-related protein rab-1c (GTP-binding protein ray)
• Ras-related protein Rab-1C
• ras-related protein Rab-35
• RAY

Background

Possesses GTPase activity

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Review for RAB35 Antibody (NBP1-79484) (1)

Average Rating: 4

(Based on 1 review)

We have 1 review tested in 1 species: Human.

reviewed by: Verified Customer ICC Human 12/22/2019

Summary

• Application: Immunocytochemistry
• Sample Tested: Dorsal root ganglion neurons
• Species: Human
• Lot: QC29286-41110

Comments

• Comments: This antibody is only listed as verified in WB so I decide to test it in ICC. I used it at 1:500, originally tried 1:300 but that was too high - I think the concentration could even be dropped to 1:1000, this may improve it's specificity. There was strong plasma membrane binding which is consistent with tagged construct expression. Some non-specific binding in the nucleus/ nucleolus which may improve with lowered antibody concentrations. Primary incubation was performed overnight at 4C, secondary antibodies (Alexa 488 and 546) at room temperature. ***Bio-Techne Response: This review was submitted through the legacy Novus Innovators Program, reflecting a new species or application tested on a primary antibody.***

Bioinformatics

• Gene Symbol: RAB35
• Uniprot:
  • NP_006852(Human)