RAB33B Antibody (6F4) - Azide and BSA Free

Western Blot: RAB33B Antibody (6F4) [H00083452-M01] - RAB33B monoclonal antibody (M01), clone 6F4 Analysis of RAB33B expression in A-431.

Western Blot: RAB33B Antibody (6F4) [H00083452-M01] - RAB33B monoclonal antibody (M01), clone 6F4. Analysis of RAB33B expression in HeLa.

Western Blot: RAB33B Antibody (6F4) [H00083452-M01] - RAB33B monoclonal antibody (M01), clone 6F4. Analysis of RAB33B expression in PC-12.

Western Blot: RAB33B Antibody (6F4) [H00083452-M01] - RAB33B monoclonal antibody (M01), clone 6F4. Analysis of RAB33B expression in NIH/3T3.

Sandwich ELISA: RAB33B Antibody (6F4) [H00083452-M01] - Detection limit for recombinant GST tagged RAB33B is approximately 0.03ng/ml as a capture antibody.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA
• Clone: 6F4
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

RAB33B Antibody (6F4) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse RAB33B Antibody (6F4) - Azide and BSA Free (H00083452-M01) is a monoclonal antibody validated for use in WB and ELISA. Anti-RAB33B Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: RAB33B (NP_112586, 117 a.a. ~ 206 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TNMASFHSLPSWIEECKQHLLANDIPRILVGNKCDLRSAIQVPTDLAQKFADTHSMPLFETSAKNPNDNDHVEAIFMTLAHKLKSHKPLM
• Specificity: RAB33B - RAB33B, member RAS oncogene family
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: RAB33B
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RAB33B Antibody (6F4) - Azide and BSA Free

• DKFZP434G099
• MGC138182
• RAB33B, member RAS oncogene family
• ras-related protein Rab-33B

Background

Protein transport. Probably involved in vesicular traffic

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for RAB33B Antibody (H00083452-M01)(1)

Publication using H00083452-M01

• Ishikawa T, Takizawa T, Iwaki J et al. Fc gamma receptor IIb participates in maternal IgG trafficking of human placental endothelial cells. Int J Mol Med. 2015-03-17 [PMID: 25778799]

Bioinformatics

• Gene Symbol: RAB33B
• Entrez:
  • 83452(Human)
• OMIM:
  • 605950(Human)
• Uniprot:
  • NP_112586(Human)