RAB15 Antibody

Immunocytochemistry/Immunofluorescence: RAB15 Antibody [NBP1-86231] - Staining of human cell line A-431 shows positivity in cytoplasm and centrosome. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: RAB15 Antibody [NBP1-86231] - Staining of human fallopian tube shows moderate to strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: RAB15 Antibody [NBP1-86231] - Staining of human cerebral cortex shows weak to moderate cytoplasmic positivity in neurons.

Immunohistochemistry-Paraffin: RAB15 Antibody [NBP1-86231] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.

Immunohistochemistry-Paraffin: RAB15 Antibody [NBP1-86231] - Staining of human small intestine shows strong cytoplasmic and membranous positivity in glandular cells.

Product Discontinued

RAB15 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: QPWMKTSGTHQKASRRSLLGIRLMRSRNGRWEESKGSSWRRSMAWTSMKQVPAPTSTLKSHS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RAB15
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for RAB15 Antibody

• RAB15, member RAS oncogene family
• RAB15, member RAS onocogene family
• ras-related protein Rab-15

Background

RAB15, also known as Ras-related protein Rab-15, is a 24 kDa 212 amino acid protein with a shorter, 24 kDa 208 isoform. The gene functions as a regulator of synaptic vesicle membrane flow and may act in unity with RAB3A. Current research is being conducted on RAB15 in relation to differentiating neuroblastoma, pulmonary disease and neuroblastoma. RAB15 is linked to the exocytosis, secretion, endocytosis, cell differentiation, angiogenesis and localization pathways where it interacts with RABIF, RPH3A, ATG5, CLN3 and GABARAPL1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RAB15