Recombinant Human QPCTL Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human QPCTL Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-288 of Human QPCTL full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MRSGGRGRPRLRLGERGLMEPLLPPKRRLLPRVRLLPLLLALAVGSAFYTIWSGWHRRTEELPLGRELRVPLIGSLPEARLRRVVGQLDPQRLWSTYLRPLLVVRTPGSPGNLQVRKAAPVTLQLLFLDGEEALKEWGPKDSLYGSRHLAQLMESIPHSPGPTRIQAIELFMLLDLLGAPNPTFYSHFPRTVRWFHRLRSIEKRLHRLNLLQSHPQEVMYFQPGEPFGSVEDDHIPFLRRGVPVLHLISTPFPAVWHTPADTEVNLHPPTVHNLCRILAVFLAEYLGL

Protein/Peptide Type
Recombinant Protein
Gene
QPCTL

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human QPCTL Protein

  • EC 2.3.2
  • EC 2.3.2.5
  • FLJ20084
  • glutaminyl cyclase-like
  • glutaminyl-peptide cyclotransferase-like protein
  • glutaminyl-peptide cyclotransferase-like
  • Golgi-resident glutaminyl-peptide cyclotransferase
  • gQC
  • isoQC

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
NBP2-41103
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB110-60935
Species: Hu, Mu, Pm
Applications: WB
NBP1-89655
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90558
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IF
MAB8210
Species: Hu
Applications: Flow, IHC, Block, CyTOF-ready
NBP1-92093
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76997
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
H00051086-D01P
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
AF5269
Species: Hu, Mu
Applications: WB, IHC
NBP2-46034
Species: Hu, Ca, Mk
Applications: WB, IHC
NBP2-24713
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, IHC-P
AF6379
Species: Hu
Applications: WB
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NBP2-19997
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-14950
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF6915
Species: Hu, Mu, Rt
Applications: WB

Publications for QPCTL Recombinant Protein (H00054814-P01) (0)

There are no publications for QPCTL Recombinant Protein (H00054814-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for QPCTL Recombinant Protein (H00054814-P01) (0)

There are no reviews for QPCTL Recombinant Protein (H00054814-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for QPCTL Recombinant Protein (H00054814-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional QPCTL Products

Bioinformatics Tool for QPCTL Recombinant Protein (H00054814-P01)

Discover related pathways, diseases and genes to QPCTL Recombinant Protein (H00054814-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for QPCTL Recombinant Protein (H00054814-P01)

Discover more about diseases related to QPCTL Recombinant Protein (H00054814-P01).
 

Pathways for QPCTL Recombinant Protein (H00054814-P01)

View related products by pathway.

Blogs on QPCTL

There are no specific blogs for QPCTL, but you can read our latest blog posts.

Customers Who Bought This Also Bought

BDNF [Unconjugated]
248-BD-005/CF
QPCTL Antibody
H00054814-B01P

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human QPCTL Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol QPCTL