Recombinant Human PXDN Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human PXDN Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1452-1561 of Human PXDN partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:STSAFSTRSDASGTNDFREFVLEMQKTITDLRTQIKKLESRLSTTECVDAGGESHANNTKWKKDACTICECKDGQVTCFVEACPPATCAVPVNIPGACCPVCLQKRAEEK

Protein/Peptide Type
Partial Recombinant Protein
Gene
PXDN

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PXDN Protein

  • peroxidasin homolog (Drosophila)

Background

PXDN - peroxidasin homolog (Drosophila)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45923
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91228
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-00532
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB600-1293
Species: Hu, Mu, Rt, Am, Bv, Ca, Ch, Tr
Applications: WB, ICC/IF, IHC, IHC-Fr
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-85383
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
H00001434-M08
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-58200
Species: Hu, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82455
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
AF5626
Species: Hu
Applications: WB, ICC
NBP2-38206
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-36561
Species: Hu, Mu
Applications: WB, B/N, ELISA, Flow, ICC/IF, IHC-Fr, IP

Publications for PXDN Partial Recombinant Protein (H00007837-Q01) (0)

There are no publications for PXDN Partial Recombinant Protein (H00007837-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PXDN Partial Recombinant Protein (H00007837-Q01) (0)

There are no reviews for PXDN Partial Recombinant Protein (H00007837-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PXDN Partial Recombinant Protein (H00007837-Q01). (Showing 1 - 1 of 1 FAQ).

  1. What is the molecular weight of PXDN?
    • PXDN protein is 165kDa in size.

Additional PXDN Products

Bioinformatics Tool for PXDN Partial Recombinant Protein (H00007837-Q01)

Discover related pathways, diseases and genes to PXDN Partial Recombinant Protein (H00007837-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PXDN Partial Recombinant Protein (H00007837-Q01)

Discover more about diseases related to PXDN Partial Recombinant Protein (H00007837-Q01).
 

Pathways for PXDN Partial Recombinant Protein (H00007837-Q01)

View related products by pathway.

PTMs for PXDN Partial Recombinant Protein (H00007837-Q01)

Learn more about PTMs related to PXDN Partial Recombinant Protein (H00007837-Q01).

Blogs on PXDN

There are no specific blogs for PXDN, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PXDN Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PXDN