Recombinant Human PXDN Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human PXDN Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1452-1561 of Human PXDN

Source: Wheat Germ

Amino Acid Sequence: STSAFSTRSDASGTNDFREFVLEMQKTITDLRTQIKKLESRLSTTECVDAGGESHANNTKWKKDACTICECKDGQVTCFVEACPPATCAVPVNIPGACCPVCLQKRAEEK

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
PXDN
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
37.84 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PXDN Protein

  • peroxidasin homolog (Drosophila)

Background

PXDN - peroxidasin homolog (Drosophila)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45923
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67627
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-00532
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-91258
Species: Hu, Mu, Bv, Fe
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NB600-1293
Species: Hu, Mu, Rt, Am, Bv, Ca, Ch, Tr
Applications: WB, ICC/IF, IHC, IHC-Fr, ICC
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NBP2-25159
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
NBP1-85383
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
H00001434-M08
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-22981
Species: Hu
Applications: IHC, IHC-P, IP
NBP1-82455
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
AF5626
Species: Hu
Applications: WB, ICC
NBP2-38206
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-36561
Species: Hu, Mu
Applications: WB, B/N, ELISA, Flow, ICC/IF, IHC-Fr, IP

Publications for PXDN Partial Recombinant Protein (H00007837-Q01) (0)

There are no publications for PXDN Partial Recombinant Protein (H00007837-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PXDN Partial Recombinant Protein (H00007837-Q01) (0)

There are no reviews for PXDN Partial Recombinant Protein (H00007837-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PXDN Partial Recombinant Protein (H00007837-Q01). (Showing 1 - 1 of 1 FAQ).

  1. What is the molecular weight of PXDN?
    • PXDN protein is 165kDa in size.

Additional PXDN Products

Bioinformatics Tool for PXDN Partial Recombinant Protein (H00007837-Q01)

Discover related pathways, diseases and genes to PXDN Partial Recombinant Protein (H00007837-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PXDN Partial Recombinant Protein (H00007837-Q01)

Discover more about diseases related to PXDN Partial Recombinant Protein (H00007837-Q01).
 

Pathways for PXDN Partial Recombinant Protein (H00007837-Q01)

View related products by pathway.

PTMs for PXDN Partial Recombinant Protein (H00007837-Q01)

Learn more about PTMs related to PXDN Partial Recombinant Protein (H00007837-Q01).

Blogs on PXDN

There are no specific blogs for PXDN, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PXDN Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PXDN