PTGIR Antibody (4B10) - Azide and BSA Free

Western Blot: PTGIR Antibody (4B10) [H00005739-M01] - Analysis of PTGIR expression in transfected 293T cell line by PTGIR monoclonal antibody (M01), clone 4B10.Lane 1: PTGIR transfected lysate(41 KDa).Lane 2: Non-transfected lysate.

Immunohistochemistry-Paraffin: PTGIR Antibody (4B10) [H00005739-M01] - Analysis of monoclonal antibody to PTGIR on formalin-fixed paraffin-embedded human tonsil. Antibody concentration 3 ug/ml.

Western Blot: PTGIR Antibody (4B10) [H00005739-M01] - PTGIR monoclonal antibody (M01), clone 4B10 Analysis of PTGIR expression in A-549.

ELISA: PTGIR Antibody (4B10) [H00005739-M01] - Detection limit for recombinant GST tagged PTGIR is approximately 0.1ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, IHC
• Clone: 4B10
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

PTGIR Antibody (4B10) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: PTGIR (NP_000951, 296 a.a. ~ 386 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RKAVFQRLKLWVCCLCLGPAHGDSQTPLSQLASGRRDPRAPSAPVGKEGSCVPLSAWGEGQVEPLPPTQQSSGSAVGTSSKAEASVACSLC
• Localization: Cell Membrane
• Specificity: PTGIR - prostaglandin I2 (prostacyclin) receptor (IP)
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: PTGIR
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500
• Application Notes: Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IHC-P and ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PTGIR Antibody (4B10) - Azide and BSA Free

• IP
• MGC102830
• PGI receptor
• PGI2 receptor
• PRIPR
• prostacyclin receptor
• prostaglandin I2 (prostacyclin) receptor (IP)
• Prostaglandin I2 receptor
• Prostanoid IP receptor
• PTGIR

Background

The protein encoded by this gene is a member of the G-protein coupled receptor family 1 and has been shown to be a receptor for prostacyclin. Prostacyclin, the major product of cyclooxygenase in macrovascular endothelium, elicits a potent vasodilation and inhibition of platelet aggregation through binding to this receptor.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PTGIR Antibody (H00005739-M01)(1)

Publication using H00005739-M01

• Baro L, Islam A, Brown HM et al. APC-driven actin nucleation powers collective cell dynamics in colorectal cancer cells iScience 2023-05-19 [PMID: 37128612]
  
  Details:
  Dilution: 1:1000

Bioinformatics

• Gene Symbol: PTGIR
• Entrez:
  • 5739(Human)
• OMIM:
  • 600022(Human)
• Uniprot:
  • NP_000951()