PTGIR Antibody (4B10)

Images

 
Western Blot: PTGIR Antibody (4B10) [H00005739-M01] - PTGIR monoclonal antibody (M01), clone 4B10 Analysis of PTGIR expression in A-549.
Immunohistochemistry-Paraffin: PTGIR Antibody (4B10) [H00005739-M01] - Analysis of monoclonal antibody to PTGIR on formalin-fixed paraffin-embedded human tonsil. Antibody concentration 3 ug/ml.
Western Blot: PTGIR Antibody (4B10) [H00005739-M01] - Analysis of PTGIR expression in transfected 293T cell line by PTGIR monoclonal antibody (M01), clone 4B10.Lane 1: PTGIR transfected lysate(41 KDa).Lane 2: ...read more
Sandwich ELISA: PTGIR Antibody (4B10) [H00005739-M01] - Detection limit for recombinant GST tagged PTGIR is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC-P
Clone
4B10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

PTGIR Antibody (4B10) Summary

Immunogen
PTGIR (NP_000951 296 a.a. - 386 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RKAVFQRLKLWVCCLCLGPAHGDSQTPLSQLASGRRDPRAPSAPVGKEGSCVPLSAWGEGQVEPLPPTQQSSGSAVGTSSKAEASVACSLC
Localization
Cell Membrane
Specificity
PTGIR - prostaglandin I2 (prostacyclin) receptor (IP)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PTGIR
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IHC-P and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PTGIR Antibody (4B10)

  • IP
  • MGC102830
  • PGI receptor
  • PGI2 receptor
  • PRIPR
  • prostacyclin receptor
  • prostaglandin I2 (prostacyclin) receptor (IP)
  • Prostaglandin I2 receptor
  • Prostanoid IP receptor
  • PTGIR

Background

The protein encoded by this gene is a member of the G-protein coupled receptor family 1 and has been shown to be a receptor for prostacyclin. Prostacyclin, the major product of cyclooxygenase in macrovascular endothelium, elicits a potent vasodilation and inhibition of platelet aggregation through binding to this receptor.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP1-84833
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NLS1049
Species: Hu, Eq, Mk, Pm
Applications: IHC-P, ICC
MAB6656
Species: Hu
Applications: WB, IHC
AF2667
Species: Hu
Applications: WB, IHC
NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84835
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-71688
Species: Hu, Mu, Po
Applications: WB, Simple Western, ICC/IF
NBP2-38648
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87069
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-87822
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB7788
Species: Hu
Applications: WB, Simple Western

Publications for PTGIR Antibody (H00005739-M01) (0)

There are no publications for PTGIR Antibody (H00005739-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PTGIR Antibody (H00005739-M01) (0)

There are no reviews for PTGIR Antibody (H00005739-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PTGIR Antibody (H00005739-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PTGIR Products

Bioinformatics Tool for PTGIR Antibody (H00005739-M01)

Discover related pathways, diseases and genes to PTGIR Antibody (H00005739-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PTGIR Antibody (H00005739-M01)

Discover more about diseases related to PTGIR Antibody (H00005739-M01).
 

Pathways for PTGIR Antibody (H00005739-M01)

View related products by pathway.

PTMs for PTGIR Antibody (H00005739-M01)

Learn more about PTMs related to PTGIR Antibody (H00005739-M01).
 

Research Areas for PTGIR Antibody (H00005739-M01)

Find related products by research area.

Blogs on PTGIR

There are no specific blogs for PTGIR, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PTGIR Antibody (4B10) and receive a gift card or discount.

Bioinformatics

Gene Symbol PTGIR
Entrez
OMIM
Uniprot