Home » PTCHD3 » PTCHD3 Antibodies » PTCHD3 Antibody - BSA Free

PTCHD3 Antibody - BSA Free

 Submit a Review

Images

 
(
Enlarge)
Western Blot: PTCHD3 Antibody [NBP2-85558] - Host: Rabbit. Target Name: PTCHD3. Sample Tissue: Mouse Pancreas lysates. Antibody Dilution: 1ug/ml
Western Blot: PTCHD3 Antibody [NBP2-85558] - Host: Rabbit. Target Name: PTCHD3. Sample Tissue: Mouse Pancreas lysates. Antibody Dilution: 1ug/ml

Product Details

Summary
Product Discontinued
View other related PTCHD3 Primary Antibodies

Order Details


    • Catalog Number
      NBP2-85558
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

PTCHD3 Antibody - BSA Free Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of mouse PTCHD3. Peptide sequence: GTGLIFLPKEKENLEEQYTPIGSPAKAERRFVQGHFSTNDTYRFSASRTS The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
PTCHD3
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified

Alternate Names for PTCHD3 Antibody - BSA Free

  • PTCHD3 patched domain containing 3
  • PTR

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

SMOX Antibody -
Azide and BSA Free
NBP3-04509
Immunohistochemistry-Paraffin SMOX Antibody - Azide and BSA Free
Western Blot SMOX Antibody - Azide and BSA Free
Immunohistochemistry-Paraffin SMOX Antibody - Azide and BSA Free
(1 Publication)
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB
Recombinant Human
PRH2 GST (N-Term) Pro ...
H00005555-P01
SDS-PAGE Recombinant Human PRH2 GST (N-Term) Protein
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Albumin Antibody
(188835) [Unconjugate ...
MAB1455
Simple Western Albumin Antibody (188835) [Unconjugated] - Serum
Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum
Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum
(3 Reviews)
(57 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Pallidin Antibody
(OTI1H9)
NBP2-01763
Western Blot Pallidin Antibody (OTI1H9)
Flow Cytometry Pallidin Antibody (OTI1H9)
Immunohistochemistry-Paraffin Pallidin Antibody (OTI1H9)
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
PRH1 Antibody -
BSA Free
NBP3-46899
Western Blot PRH1 Antibody - BSA Free
Species: Hu
Applications: ELISA, ICC/IF, WB
Coagulation Factor
II/Thrombin Antibody ...
AF1148
Simple Western Coagulation Factor II/Thrombin Antibody [Unconjugated]
Flow Cytometry Coagulation Factor II/Thrombin Antibody [Unconjugated]
Western Blot Coagulation Factor II/Thrombin Antibody [Unconjugated]
(1 Publication)
Species: Hu
Applications: CyTOF-ready, Flow, Simple Western, WB
Pancreatic Amylase
Alpha Antibody - BSA ...
NBP3-38499
N/A Pancreatic Amylase Alpha Antibody - BSA Free
N/A Pancreatic Amylase Alpha Antibody - BSA Free
N/A Pancreatic Amylase Alpha Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Histatin 3
Antibody (4G9) - Azid ...
H00003347-M01
Sandwich ELISA Histatin 3 Antibody (4G9) - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence Histatin 3 Antibody (4G9) - Azide and BSA Free
(1 Publication)
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
Endothelial Lipase
Antibody - BSA Free
NB400-111
Immunocytochemistry/ Immunofluorescence Endothelial Lipase Antibody - BSA Free
Western Blot Endothelial Lipase Antibody - BSA Free
Western Blot Endothelial Lipase Antibody - BSA Free
(6 Publications)
Species: Hu, Mu(-)
Applications: ICC/IF, IHC, IHC-Fr, WB
EPB42 Antibody
(2G12) - Azide and BS ...
H00002038-M01
Western Blot EPB42 Antibody (2G12) - Azide and BSA Free
ELISA EPB42 Antibody (2G12) - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence EPB42 Antibody (2G12) - Azide and BSA Free
Species: Hu
Applications: ELISA, ICC/IF, WB
FGF-4
[Unconjugated]
235-F4
SDS-PAGE FGF-4 [Unconjugated]
Bioactivity FGF-4 [Unconjugated]
(84 Publications)
Species: Hu
Applications: BA
HFE Antibody - BSA
Free
NBP1-83250
Immunohistochemistry HFE Antibody - BSA Free
Immunohistochemistry-Paraffin HFE Antibody - BSA Free
Immunohistochemistry-Paraffin HFE Antibody - BSA Free
(1 Publication)
Species: Hu
Applications: IHC,  IHC-P, WB
C-Reactive
Protein/CRP [Biotin]
DY1707
N/A C-Reactive Protein/CRP [Biotin]
(75 Publications)
Species: Hu
Applications: ELISA
Recombinant Human
Fucosyltransferase 1/ ...
H00002523-P01
Other Recombinant Human Fucosyltransferase 1/FUT1 GST (N-Term) Protein
Species: Hu
Applications: ELISA, AP, PA, WB
Cytosolic
Sulfotransferase 2A1/ ...
AF5828
Immunocytochemistry Cytosolic Sulfotransferase 2A1/SULT2A1 Antibody
Western Blot Cytosolic Sulfotransferase 2A1/SULT2A1 Antibody
Species: Hu
Applications: ICC, Neut, WB
Factor IX Antibody
- Azide and BSA Free
NBP1-33581
Immunohistochemistry-Paraffin Factor IX Antibody - Azide and BSA Free
Immunohistochemistry-Paraffin Factor IX Antibody - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence Factor IX Antibody - Azide and BSA Free
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
MUC13 Antibody -
BSA Free
NBP2-24566
Western Blot MUC13 Antibody - BSA Free
Immunohistochemistry-Paraffin MUC13 Antibody - BSA Free
Western Blot MUC13 Antibody - BSA Free
(1 Publication)
Species: Hu
Applications: IHC,  IHC-P, WB
Fucosyltransferase
2/FUT2
7770-GT
Fucosyltransferase 2/FUT2
(2 Publications)
Species: Hu
Applications: EnzAct

Publications for PTCHD3 Antibody (NBP2-85558) (0)

There are no publications for PTCHD3 Antibody (NBP2-85558).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PTCHD3 Antibody (NBP2-85558) (0)

There are no reviews for PTCHD3 Antibody (NBP2-85558). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PTCHD3 Antibody (NBP2-85558) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PTCHD3 Products

Blogs on PTCHD3

There are no specific blogs for PTCHD3, but you can read our latest blog posts.

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PTCHD3 Antibody - BSA Free and receive a gift card or discount.


Bioinformatics

Gene Symbol PTCHD3