PSMD8 Antibody - Azide and BSA Free

Western Blot: PSMD8 Antibody [H00005714-B02P] - Analysis of PSMD8 expression in human placenta.

Western Blot: PSMD8 Antibody [H00005714-B02P] - Analysis of PSMD8 expression in transfected 293T cell line by PSMD8 polyclonal antibody. Lane 1: PSMD8 transfected lysate(28.27 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

PSMD8 Antibody - Azide and BSA Free Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: PSMD8 (NP_002803.1, 1 a.a. - 257 a.a.) full-length human protein. MYEQLKGEWNRKSPNLSKCGEELGRLKLVLLELNFLPTTGTKLTKQQLILARDILEIGAQWSILRKDIPSFERYMAQLKCYYFDYKEQLPESAYMHQLLGLNLLFLLSQNRVAEFHTELERLPAKDIQTNVYIKHPVSLEQYLMEGSYNKVFLAKGNIPAESYTFFIDILLDTIRDEIAGCIEKAYEKILFTEATRILFFNTPKKMTDYAKKRGWVLGPNNYYSFASQQQKPEDTTIPSTELAKQVIEYARQLEMIV
• Specificity: PSMD8 - proteasome (prosome, macropain) 26S subunit, non-ATPase, 8,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: PSMD8
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PSMD8 Antibody - Azide and BSA Free

• 26S proteasome non-ATPase regulatory subunit 8
• 26S proteasome regulatory subunit p31
• HIP6,26S proteasome regulatory subunit S14
• HYPF
• MGC1660
• Nin1p
• p3126S proteasome regulatory subunit RPN12
• proteasome (prosome, macropain) 26S subunit, non-ATPase, 8
• Rpn12
• S14

Background

The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a non-ATPase subunit of the 19S regulator. A pseudogene has been identified on chromosome 1. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PSMD8
• Entrez:
  • 5714(Human)
• Uniprot:
  • NP_002803.1(Human)