PSGR Antibody - BSA Free

Western Blot: PSGR Antibody [NBP2-86757] - WB Suggested Anti-OR51E2 Antibody. Titration: 1.0 ug/ml. Positive Control: HepG2 Whole Cell

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

PSGR Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human PSGR. Peptide sequence: VRVVMGDIYLLLPPVINPIIYGAKTKQIRTRVLAMFKISCDKDLQAVGGK The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: OR51E2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for PSGR Antibody - BSA Free

• HPRAJ
• Olfactory Receptor OR11-16
• olfactory receptor, family 51, subfamily E, member 2
• olfactory receptor, family 51, subfamily E, member 3 pseudogene
• olfactory receptor, family 52, subfamily A, member 2
• OR51E2
• OR51E3P
• OR52A2
• prostate specific G-protein coupled receptor
• Prostate-specific G-protein coupled receptor
• PSGR
• PSGRolfactory receptor 51E2

Background

Prostate-specific G protein-coupled receptor possesses homology to the Olfactory Receptor family. It is expressed specifically in normal prostate, and its expression is upregulated in prostate carcinoma. Prostate-specific G protein-coupled receptor has been shown to be expressed primarily in normal prostate and to be overexpressed in prostate carcinoma. In humans, it has also been shown to be expressed in the olfactory epithelium and, to a lesser extent, in the medulla of the brain. ESTs have been isolated from prostate libraries.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: OR51E2