PRRG1 Antibody

Images

 
Immunohistochemistry: PRRG1 Antibody [NBP2-30623] - Staining of human kidney shows strong cytoplasmic positivity in distal tubules.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PRRG1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: ENNEKTKEFWSTYTKAQQGESNRGSDWFQFY
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PRRG1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PRRG1 Protein (NBP2-30623PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PRRG1 Antibody

  • PRGP1TMG1
  • proline rich Gla (G-carboxyglutamic acid) 1
  • Proline-rich gamma-carboxyglutamic acid protein 1
  • proline-rich Gla (G-carboxyglutamic acid) polypeptide 1
  • Proline-rich Gla protein 1
  • transmembrane gamma-carboxyglutamic acid protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF6146
Species: Hu
Applications: ICC
NBP1-47863
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92310
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-07799
Species: Hu
NBP1-36727
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IHC-P, IP, CyTOF-ready
NBP2-16651
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-27335
Species: Hu
Applications: WB, Flow, CyTOF-ready
AF650
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB400-114
Species: Hu, Mu, Rt, Po, Ch, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-87229
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
DDX0191P-100
Species: Hu, Mu, Ca, Fe, Sh
Applications: ICC/IF, IHC, IHC-P
NBP2-43728
Species: Hu
Applications: WB, ICC/IF
NBP2-15229
Species: Hu
Applications: WB
MAB1419
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
NBP1-27972
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF6897
Species: Hu, Mu
Applications: WB, IHC
NB100-74605
Species: Hu, Mu
Applications: WB, IP
NBP1-92158
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-57602
Species: Hu
Applications: ICC/IF

Publications for PRRG1 Antibody (NBP2-30623) (0)

There are no publications for PRRG1 Antibody (NBP2-30623).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PRRG1 Antibody (NBP2-30623) (0)

There are no reviews for PRRG1 Antibody (NBP2-30623). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PRRG1 Antibody (NBP2-30623) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PRRG1 Products

Bioinformatics Tool for PRRG1 Antibody (NBP2-30623)

Discover related pathways, diseases and genes to PRRG1 Antibody (NBP2-30623). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PRRG1 Antibody (NBP2-30623)

Discover more about diseases related to PRRG1 Antibody (NBP2-30623).
 

Pathways for PRRG1 Antibody (NBP2-30623)

View related products by pathway.

PTMs for PRRG1 Antibody (NBP2-30623)

Learn more about PTMs related to PRRG1 Antibody (NBP2-30623).

Blogs on PRRG1

There are no specific blogs for PRRG1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PRRG1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PRRG1
Uniprot