PRRC2C Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: PRRC2C Antibody [NBP1-88703] - Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol.
Immunohistochemistry-Paraffin: PRRC2C Antibody [NBP1-88703] - Staining of human colon shows moderate positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PRRC2C Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:DVRPHHTDANNQSACFEAPDQKTLSTPQEERISAVESQPSRKRSVSHGSNHTQKPDEQRSEPSAGIPKVTSRCIDSKEP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PRRC2C
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PRRC2C Protein (NBP1-88703PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PRRC2C Antibody

  • BAT2D1
  • HBV X-transactivated gene 2 protein
  • HLA-B-associated transcript 2-like 2
  • proline-rich coiled-coil 2C

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56628
Species: Hu
Applications: WB
NBP2-07996
Species: Hu
H00008360-R01
Species: Hu
NBP2-37507
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBL1-11570
Species: Hu
NBL1-11569
Species: Hu
NBP2-10888
Species: Hu
NB21-2024
Species: Hu, Mu, Rt, Ma
Applications: WB, ChIP, DB, ICC/IF
H00008365-M01
Species: Hu
Applications: ELISA, ICC/IF
NBP2-22273
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBL1-11567
Species: Hu
NBP2-34082
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-268
Species: Hu, Rt, Po
Applications: WB, IP
NBP1-90609
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-81232
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-24945
Species: Hu, Mu, Rt, Po, Ca, Pm
Applications: WB

Publications for PRRC2C Antibody (NBP1-88703) (0)

There are no publications for PRRC2C Antibody (NBP1-88703).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PRRC2C Antibody (NBP1-88703) (0)

There are no reviews for PRRC2C Antibody (NBP1-88703). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for PRRC2C Antibody (NBP1-88703) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PRRC2C Products

Bioinformatics Tool for PRRC2C Antibody (NBP1-88703)

Discover related pathways, diseases and genes to PRRC2C Antibody (NBP1-88703). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on PRRC2C

There are no specific blogs for PRRC2C, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PRRC2C Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PRRC2C