Protocadherin-8 Antibody (1C5)

Images

 
Sandwich ELISA: Protocadherin-8 Antibody (1C5) [H00005100-M02] - Detection limit for recombinant GST tagged PCDH8 is 0.1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1C5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Protocadherin-8 Antibody (1C5) Summary

Immunogen
PCDH8 (NP_002581, 32 a.a. - 120 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VRYSTFEEDAPGTVIGTLAEDLHMKVSGDTSFRLMKQFNSSLLRVREGDGQLTVGDAGLDRERLCGQAPQCVLAFDVVSFSQEQFRLVH
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PCDH8
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
It has been used for ELISA and WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Protocadherin-8 Antibody (1C5)

  • Arcadlin
  • PAPC
  • PCDH8
  • protocadherin 8
  • Protocadherin8
  • Protocadherin-8

Background

This gene belongs to the protocadherin gene family, a subfamily of the cadherin superfamily. The gene encodes an integral membrane protein that is thought to function in cell adhesion in a CNS-specific manner. Unlike classical cadherins, which are generally encoded by 15-17 exons, this gene includes only 3 exons. Notable is the large first exon encoding the extracellular region, including 6 cadherin domains and a transmembrane region. Alternative splicing yields isoforms with unique cytoplasmic tails. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-19719
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-52979
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00005097-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-05950
Species: Hu, Mu
Applications: WB, ICC/IF
AF7669
Species: Hu, Mu, Rt
Applications: WB
AF198
Species: Mu
Applications: WB, IHC
MAB8626
Species: Hu
Applications: Flow, CyTOF-ready
NBP1-80939
Species: Hu
Applications: IHC, IHC-P
MAB208
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
NBP1-82432
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46340
Species: Hu
Applications: WB, IHC, IF
NBL1-14149
Species: Hu
NBP1-77005
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
35740002
Species: Hu
Applications: WB, ELISA

Publications for Protocadherin-8 Antibody (H00005100-M02) (0)

There are no publications for Protocadherin-8 Antibody (H00005100-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Protocadherin-8 Antibody (H00005100-M02) (0)

There are no reviews for Protocadherin-8 Antibody (H00005100-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Protocadherin-8 Antibody (H00005100-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Protocadherin-8 Products

Bioinformatics Tool for Protocadherin-8 Antibody (H00005100-M02)

Discover related pathways, diseases and genes to Protocadherin-8 Antibody (H00005100-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Protocadherin-8 Antibody (H00005100-M02)

Discover more about diseases related to Protocadherin-8 Antibody (H00005100-M02).
 

Pathways for Protocadherin-8 Antibody (H00005100-M02)

View related products by pathway.

PTMs for Protocadherin-8 Antibody (H00005100-M02)

Learn more about PTMs related to Protocadherin-8 Antibody (H00005100-M02).

Blogs on Protocadherin-8

There are no specific blogs for Protocadherin-8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Protocadherin-8 Antibody (1C5) and receive a gift card or discount.

Bioinformatics

Gene Symbol PCDH8
Entrez
Uniprot