Protocadherin-17 Antibody - BSA Free

Western Blot: Protocadherin-17 Antibody [NBP2-94167] - Analysis of extracts of 293T cells, using Protocadherin-17 .Exposure time: 60s.

Product Discontinued

Protocadherin-17 Antibody - BSA Free Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 610-710 of human PCDH17 (NP_001035519.1). VRALDSDFGESGRLTYEIVDGNDDHLFEIDPSSGEIRTLHPFWEDVTPVVELVVKVTDHGKPTLSAVAKLIIRSVSGSLPEGVPRVNGEQHHWDMSLPLIV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PCDH17
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500-1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Protocadherin-17 Antibody - BSA Free

• PCDH17
• PCDH68
• PCDH68protocadherin-68
• PCH68
• PCH68Protocadherin-68
• protocadherin 17
• protocadherin 68
• Protocadherin17
• Protocadherin-17

Background

The PCDH17 gene belongs to the protocadherin gene family, a subfamily of the cadherin superfamily. The encoded protein contains six extracellular cadherin domains, a transmembrane domain, and a cytoplasmic tail differing from those of the classical cadherins. T

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PCDH17