Protocadherin-17 Antibody

Images

 
Western Blot: Protocadherin-17 Antibody [NBP1-54818] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Protocadherin-17 Antibody Summary

Immunogen
Synthetic peptides corresponding to PCDH17(protocadherin 17) The peptide sequence was selected from the C terminal of PCDH17. Peptide sequence SEMGAVLEQLDHPNRDLGRESVDAEEVVREIDKLLQDCRGNDPVAVRK.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PCDH17
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against PCDH17 and was validated on Western blot.
Theoretical MW
124 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Protocadherin-17 Antibody

  • PCDH17
  • PCDH68
  • PCDH68protocadherin-68
  • PCH68
  • PCH68Protocadherin-68
  • protocadherin 17
  • protocadherin 68
  • Protocadherin17
  • Protocadherin-17

Background

PCDH17 contains six extracellular cadherin domains, a transmembrane domain, and a cytoplasmic tail differing from those of the classical cadherins.It may play a role in the establishment and function of specific cell-cell connections in the brain.This gene belongs to the protocadherin gene family, a subfamily of the cadherin superfamily. The encoded protein contains six extracellular cadherin domains, a transmembrane domain, and a cytoplasmic tail differing from those of the classical cadherins. The encoded protein may play a role in the establishment and function of specific cell-cell connections in the brain. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-866 AL445288.9 90051-90916 867-4389 BC028165.1 1-3523 4390-8009 AL445216.6 89335-92954

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81410
Species: Hu
Applications: IHC, IHC-P
NBP2-61772
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
H00005097-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
AF5434
Species: Hu
Applications: WB, ICC
NBP1-80939
Species: Hu
Applications: IHC, IHC-P
MAB8626
Species: Hu
Applications: Flow, CyTOF-ready
NBP2-46340
Species: Hu
Applications: WB, IHC, IF
H00083259-Q01
Species: Hu
NBP1-88182
Species: Hu
Applications: WB, IHC, IHC-P
5604-CA
Species: Hu
NBP2-27372
Species: Hu, Mu, Ma
Applications: WB
6774-CA
Species: Hu
AF2715
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-77005
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-43538
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-06983
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC-P, IP, PEP-ELISA
NB110-40773
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
MAB1790
Species: Hu
Applications: WB, Simple Western, IHC
H00028513-B01P
Species: Hu
Applications: WB, ELISA
NBP2-30010
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for Protocadherin-17 Antibody (NBP1-54818) (0)

There are no publications for Protocadherin-17 Antibody (NBP1-54818).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Protocadherin-17 Antibody (NBP1-54818) (0)

There are no reviews for Protocadherin-17 Antibody (NBP1-54818). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Protocadherin-17 Antibody (NBP1-54818) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Protocadherin-17 Antibody (NBP1-54818)

Discover related pathways, diseases and genes to Protocadherin-17 Antibody (NBP1-54818). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Protocadherin-17 Antibody (NBP1-54818)

Discover more about diseases related to Protocadherin-17 Antibody (NBP1-54818).
 

Pathways for Protocadherin-17 Antibody (NBP1-54818)

View related products by pathway.

PTMs for Protocadherin-17 Antibody (NBP1-54818)

Learn more about PTMs related to Protocadherin-17 Antibody (NBP1-54818).

Blogs on Protocadherin-17

There are no specific blogs for Protocadherin-17, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Protocadherin-17 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PCDH17
Entrez
Uniprot