Proteasome 19S S7 Recombinant Protein Antigen

Images

 
There are currently no images for Proteasome 19S S7 Recombinant Protein Antigen (NBP2-56743PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Proteasome 19S S7 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Proteasome 19S S7.

Source: E. coli

Amino Acid Sequence: KQTLQSEQPLQVARCTKIINADSEDPKYIINVKQFAKFVVDLSDQVAPTDIEEGMRVGVDRNKYQIHIPLPPKIDPTVTMMQV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PSMC2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56743.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Proteasome 19S S7 Recombinant Protein Antigen

  • 26S protease regulatory subunit 7
  • 26S proteasome AAA-ATPase subunit RPT1
  • MGC3004
  • MSS1ATPase, 2
  • proteasome (prosome, macropain) 26S subunit, ATPase, 2
  • Protein MSS1
  • putative protein product of Nbla10058

Background

The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes one of the ATPase subunits, a member of the triple-A family of ATPases which have a chaperone-like activity. This subunit has been shown to interact with several of the basal transcription factors so, in addition to participation in proteasome functions, this subunit may participate in the regulation of transcription. This subunit may also compete with PSMC3 for binding to the HIV tat protein to regulate the interaction between the viral protein and the transcription complex.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80959
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-46655
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
NBP3-46656
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
NB100-345
Species: Hu
Applications: ChIP, IP, KD, WB
NBP2-94504
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP1-33691
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP2-73636
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: CyTOF-ready, Flow, WB
NBP3-27806
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IP, WB
NBP2-88192
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-87799
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-46191
Species: Dr, Hu, Mu
Applications: IP, WB
NB100-1595
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, WB
NBP2-38780
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-56350
Species: Hu, Mu, Rt
Applications: WB
NBP2-94502
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
NBP1-81545
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-2682
Species: Hu, Mu
Applications: CyTOF-ready, ELISA, Flow-CS, Flow, ICC/IF, IF, IHC, IHC-Fr,  IHC-P, IP, WB
H00006193-M02
Species: Hu, Mu, Pr, Rt
Applications: ELISA, ICC/IF, WB
NBP2-38323
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-83254
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB

Publications for Proteasome 19S S7 Recombinant Protein Antigen (NBP2-56743PEP) (0)

There are no publications for Proteasome 19S S7 Recombinant Protein Antigen (NBP2-56743PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Proteasome 19S S7 Recombinant Protein Antigen (NBP2-56743PEP) (0)

There are no reviews for Proteasome 19S S7 Recombinant Protein Antigen (NBP2-56743PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Proteasome 19S S7 Recombinant Protein Antigen (NBP2-56743PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Proteasome 19S S7 Products

Research Areas for Proteasome 19S S7 Recombinant Protein Antigen (NBP2-56743PEP)

Find related products by research area.

Blogs on Proteasome 19S S7

There are no specific blogs for Proteasome 19S S7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Proteasome 19S S7 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PSMC2