Prostasin/Prss8 Recombinant Protein Antigen

Images

 
There are currently no images for Prostasin/Prss8 Protein (NBP1-86340PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Prostasin/Prss8 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PRSS8.

Source: E.coli

Amino Acid Sequence: RPITFSRYIRPICLPAANASFPNGLHCTVTGWGHVAPSVSLLTPKPLQQLEVPLISRETCNCLYNIDAKPEEPHFVQEDMVCAGYV

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PRSS8
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-86340.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for Prostasin/Prss8 Recombinant Protein Antigen

  • CAP1
  • channel-activating protease 1
  • EC 3.4.21
  • EC 3.4.21.-
  • EC 3.4.21.120
  • Prostasin
  • protease, serine, 8
  • Prss8
  • Serine protease 8

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF6386
Species: Hu
Applications: WB, IP
NBP2-30572
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB4158
Species: Hu
Applications: IHC
NBP1-86641
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBL1-14964
Species: Hu
AF1141
Species: Mu
Applications: WB, IHC, IP
NBP2-01650
Species: Hu, Mu, Mk
Applications: WB, Flow, IHC, IHC-P
NB100-56487
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ICC/IF, IP
AF3946
Species: Hu
Applications: WB, CyTOF-ready, ICFlow
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
2980-PI
Species: Hu
H00003249-P01
Species: Hu
Applications: WB
NBP2-00527
Species: Hu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-1903
Species: Hu, Mu, Rt, Po, Ca, Ha, Pm
Applications: WB, B/N, Flow, ICC/IF, IHC-P, IP
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-33924
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56116
Species: Hu, Mu, Rt, Ge
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-86340PEP
Species: Hu
Applications: AC

Publications for Prostasin/Prss8 Protein (NBP1-86340PEP) (0)

There are no publications for Prostasin/Prss8 Protein (NBP1-86340PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Prostasin/Prss8 Protein (NBP1-86340PEP) (0)

There are no reviews for Prostasin/Prss8 Protein (NBP1-86340PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for Prostasin/Prss8 Protein (NBP1-86340PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for Prostasin/Prss8 Protein (NBP1-86340PEP)

Discover related pathways, diseases and genes to Prostasin/Prss8 Protein (NBP1-86340PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Prostasin/Prss8 Protein (NBP1-86340PEP)

Discover more about diseases related to Prostasin/Prss8 Protein (NBP1-86340PEP).
 

Pathways for Prostasin/Prss8 Protein (NBP1-86340PEP)

View related products by pathway.

PTMs for Prostasin/Prss8 Protein (NBP1-86340PEP)

Learn more about PTMs related to Prostasin/Prss8 Protein (NBP1-86340PEP).

Blogs on Prostasin/Prss8

There are no specific blogs for Prostasin/Prss8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

BRD4 Antibody
NB100-56487

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Prostasin/Prss8 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PRSS8
Entrez