PRMT2 Antibody - BSA Free

Western Blot: PRMT2 Antibody [NBP3-38197] - Western blot analysis of lysates from mouse lung, using [KO Validated] PRMT2 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit.Exposure time: 90s.

Immunohistochemistry: PRMT2 Antibody [NBP3-38197] - Immunohistochemistry analysis of paraffin-embedded Human liver damage using [KO Validated] PRMT2 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Immunocytochemistry/ Immunofluorescence: PRMT2 Antibody [NBP3-38197] - Immunofluorescence analysis of HeLa cells using [KO Validated] PRMT2 Rabbit pAb.Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution.

Western Blot: PRMT2 Antibody [NBP3-38197] - Western Blot analysis of lysates from wild type (WT) and PRMT2 knockout (KO) 293T cells, using [KO Validated] PRMT2 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PRMT2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PRMT2 Antibody - BSA Free (NBP3-38197) is a polyclonal antibody validated for use in IHC, WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human PRMT2 (NP_996845.1).
  
  Sequence:
  MATSGDCPRSESQGEEPAECSEAGLLQEGVQPEEFVAIADYAATDETQLSFLRGEKILILRQTTADWWWGERAGCCGYIPANHVGKHVDEYDPEDTWQDEEYFGSYGTLKLHLEMLADQPRTTKYHSVILQNKESLTDKVILDVGCGTGIISLFCAHYARPRAVYAVEASEMAQHTGQLVLQNGFADIITVYQQKVEDVVLPEKVDVLVSEWMGTCLLFEFMIESILYARDAWLKEDGVIWPTMAALHLVPCSADKDYRSKVLFWDNAYEFNLSALKSLAVKEFFSKPKYNHILKPEDCL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PRMT2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:100
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 49 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for PRMT2 Antibody - BSA Free

• EC 2.1.1.-
• EC 2.1.1.125
• Histone-arginine N-methyltransferase PRMT2
• HMT1 (hnRNP methyltransferase, S. cerevisiae)-like 1
• HMT1 hnRNP methyltransferase-like 1 (S. cerevisiae)
• HMT1 hnRNP methyltransferase-like 1
• HMT1
• HRMT1L1PRMT2 beta
• MGC111373
• PRMT2 alpha
• PRMT2 gamma
• protein arginine methyltransferase 2
• protein arginine N-methyltransferase 2

Background

PRMT2 is a member of the protein arginine N-methyltransferase family that has been shown to be both an androgen receptor (AR)-associated coactivator and an estrogen receptor. PRMT2 expression is upregulated in the lung under hypoxic conditions, and has been shown to inhibit cell activation and promote programmed cell death through a NF-kappaB-dependent mechanism.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PRMT2