PRMT10 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: PRMT10 Antibody [NBP2-59016] - Staining of human cell line A-431 shows localization to cytosol & microtubules.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PRMT10 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: VIAGTLGQVKPYSSVEKDQHRIALDLISEANHFPKETLEFWLRHVEDESAMLQRPKSDKLWSIIILDVIEPSGLIQQEIMEKAAISRCLLQ
Predicted Species
Mouse (90%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PRMT9
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PRMT10 Recombinant Protein Antigen (NBP2-59016PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for PRMT10 Antibody

  • EC 2.1.1.-
  • FLJ46629
  • protein arginine methyltransferase 10 (putative)
  • putative protein arginine N-methyltransferase 10

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-07996
Species: Hu
Applications: WB
H00008363-P01
Species: Hu
Applications: ELISA, AP, PA, WB
H00008294-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
H00008362-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NB21-2024
Species: Hu, Ma, Mu, Po, Rt
Applications: ChIP, DB, ICC/IF, WB
H00008365-M01
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA
NBP1-77144
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBL1-11567
Species: Hu
Applications: WB
MAB4165
Species: Hu
Applications: IHC, WB
NB600-836
Species: Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP1-30141
Species: Ce, Dr, Hu, In, Ma, Mu, Po, Rt, Ye
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, WB
AF2569
Species: Hu
Applications: ICC, WB
NBP2-52486
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-59016
Species: Hu, Mu, Rt
Applications: ICC/IF

Publications for PRMT10 Antibody (NBP2-59016) (0)

There are no publications for PRMT10 Antibody (NBP2-59016).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PRMT10 Antibody (NBP2-59016) (0)

There are no reviews for PRMT10 Antibody (NBP2-59016). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for PRMT10 Antibody (NBP2-59016) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PRMT10 Products

Bioinformatics Tool for PRMT10 Antibody (NBP2-59016)

Discover related pathways, diseases and genes to PRMT10 Antibody (NBP2-59016). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PRMT10 Antibody (NBP2-59016)

Discover more about diseases related to PRMT10 Antibody (NBP2-59016).
 

Pathways for PRMT10 Antibody (NBP2-59016)

View related products by pathway.

PTMs for PRMT10 Antibody (NBP2-59016)

Learn more about PTMs related to PRMT10 Antibody (NBP2-59016).
 

Research Areas for PRMT10 Antibody (NBP2-59016)

Find related products by research area.

Blogs on PRMT10

There are no specific blogs for PRMT10, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PRMT10 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PRMT9