PRKRIP1 Antibody

Images

 
Western Blot: PRKRIP1 Antibody [NBP2-13811] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: PRKRIP1 Antibody [NBP2-13811] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol & actin filaments.
Immunohistochemistry-Paraffin: PRKRIP1 Antibody [NBP2-13811] - Staining of human stomach, upper shows strong cytoplasmic and membranous positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PRKRIP1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VMGSSAGAGSGEFHVYRHLRRREYQRQDYMDAMAEKQKLDAEFQKRLEKN KIAAEEQTAKRRKKRQKL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PRKRIP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PRKRIP1 Protein (NBP2-13811PEP)
Reviewed Applications
Read 1 Review rated 5
using
NBP2-13811 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PRKRIP1 Antibody

  • C114
  • FLJ13902
  • FLJ40957
  • KRAB box domain containing 3
  • KRBOX3
  • likely ortholog of mouse C114 dsRNA-binding protein
  • PRKR interacting protein 1 (IL11 inducible)
  • PRKR-interacting protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-02669
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-77266
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
AF8519
Species: Hu, Mu, Rt
Applications: WB
NBP2-56745
Species: Hu
Applications: ICC/IF
NBP2-47466
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56725
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P, IP, Flow-IC
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-00178
Species: Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP2-39019
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-02398
Species: Hu, Mk
Applications: ELISA, IHC, IHC-P
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88888
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-57516
Species: Hu
Applications: WB
NBP2-34252
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NBP1-80073
Species: Hu, Rt
Applications: WB, IHC, IHC-P

Publications for PRKRIP1 Antibody (NBP2-13811) (0)

There are no publications for PRKRIP1 Antibody (NBP2-13811).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for PRKRIP1 Antibody (NBP2-13811) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Human.
We have 1 review tested in 1 application: WB.

Reviews using NBP2-13811:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot PRKRIP1 NBP2-13811
Enlarge
reviewed by:
Yazhong Tao
WB Human 02/04/2013
View

Summary

ApplicationWestern Blot
Sample TestedHuman T cell
SpeciesHuman
CommentsBlocked with Odyssey blocking buffer 1 hour at room temperature, incubated with
the primary antibody in blocking buffer overnight in 4 degree, washed 3 times,
incubated with secondary antibodies in blocking buffer at RT for one hour, washed 3 times.
Scaned by Licor Odyssey system.

Blocking

Blocking DetailsOdyssey blocking buffer

Primary Anitbody

Dilution Ratio1:50000

Secondary Antibody

Secondary DescriptionGoat anti rabbit 800 nm Li Cor

Details

Detection NotesLicor Odyssey system

Comments

CommentsBlocked with Odyssey blocking buffer 1 hour at room temperature, incubated with
the primary antibody in blocking buffer overnight in 4 degree, washed 3 times,
incubated with secondary antibodies in blocking buffer at RT for one hour, washed 3 times.
Scaned by Licor Odyssey system.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PRKRIP1 Antibody (NBP2-13811) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PRKRIP1 Products

Bioinformatics Tool for PRKRIP1 Antibody (NBP2-13811)

Discover related pathways, diseases and genes to PRKRIP1 Antibody (NBP2-13811). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PRKRIP1 Antibody (NBP2-13811)

Discover more about diseases related to PRKRIP1 Antibody (NBP2-13811).
 

Pathways for PRKRIP1 Antibody (NBP2-13811)

View related products by pathway.

PTMs for PRKRIP1 Antibody (NBP2-13811)

Learn more about PTMs related to PRKRIP1 Antibody (NBP2-13811).

Blogs on PRKRIP1

There are no specific blogs for PRKRIP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Yazhong Tao
02/04/2013
Application: WB
Species: Human

Bioinformatics

Gene Symbol PRKRIP1
Entrez