We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

PRICKLE1 Recombinant Protein Antigen

Images

 

Product Details

Summary
Product Discontinued
View other related PRICKLE1 Peptides and Proteins

Order Details


    • Catalog Number
      NBP1-83967PEP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

PRICKLE1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PRICKLE1.

Source: E. coli

Amino Acid Sequence: GASGYNHDETQWYEDSLECLSDLKPEQSVRDSMDSLALSNITGASVDGENKPRPSLYSLQNFEEMETEDCEKMSNMGTLNSSMLHRSAESLKSLSSELCPEKILPEEKPVHLPVLRRSKSQSRPQQVKFSDDVIDNGNYDIEI

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PRICKLE1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-83967.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PRICKLE1 Recombinant Protein Antigen

  • EPM1BMGC138902
  • FLJ31627
  • FLJ31937
  • prickle homolog 1 (Drosophila)
  • prickle-like 1 (Drosophila)
  • prickle-like 1
  • prickle-like protein 1
  • REST (RE-1 silencing transcription factor)/NRSF (neuron-restrictive silencerfactor)-interacting LIM domain protein
  • REST/NRSF-interacting LIM domain protein 1
  • RILPMGC138903

Background

PRICKLE1 has 831 amino acids and is approximately 94kDa. PRICKLE1 localizes to the nuclear membrane and is involved in the movement of REST, a transcription repressor. PRICKLE1 is implicated in pathways that regulate neural tube development and gastrulation. PRICKLE1 may also be a nuclear receptor that negatively regulates the Wnt/beta-catenin signaling pathway. Current research on PRICKLE1 is being performed in relation to several diseases and disorders including neural tube defects and progressive myoclonic epilepsy type 1B. PRICKLE1 has also been shown to interact with Dishevelled 1, Dishevelled 2, Dishevelled 3, VIP, and SMURF2 in the Wnt signaling pathway.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00338382-M01
Species: Hu
Applications: ELISA, IP, WB
NBP1-87174
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP2-81938
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
AF4815
Species: Hu, Mu, Rt
Applications: IHC, WB
AF7164
Species: Hu
Applications: WB
NBP1-86990
Species: Hu
Applications: ICC/IF, KD, WB
AF6278
Species: Hu, Mu
Applications: WB
AF1927
Species: Hu
Applications: IP, WB
NBP1-91991
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-24648
Species: Hu, Mu, Pm, Rt
Applications: WB
NBP2-55658
Species: Hu
Applications: ICC/IF
NBP3-44479
Species: Hu
Applications: ICC/IF,  IHC-P
AF2440
Species: Mu
Applications: IHC, WB
NBP3-46828
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
AF1001
Species: Mu
Applications: IHC
NB120-19294
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
236-EG
Species: Hu
Applications: BA
NBP1-83967PEP
Species: Hu
Applications: AC

Publications for PRICKLE1 Protein (NBP1-83967PEP) (0)

There are no publications for PRICKLE1 Protein (NBP1-83967PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PRICKLE1 Protein (NBP1-83967PEP) (0)

There are no reviews for PRICKLE1 Protein (NBP1-83967PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PRICKLE1 Protein (NBP1-83967PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PRICKLE1 Products

Array NBP1-83967PEP

Research Areas for PRICKLE1 Protein (NBP1-83967PEP)

Find related products by research area.

Blogs on PRICKLE1

There are no specific blogs for PRICKLE1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PRICKLE1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PRICKLE1