PRICKLE1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: PRICKLE1 Antibody [NBP1-83967] - Staining of human pancreatic frozen tissue sections stained with PRICKLE1 antibody (red). Nuclei labeled with DAPI (blue). Image from verified ...read more
Immunohistochemistry-Paraffin: PRICKLE1 Antibody [NBP1-83967] - Staining of human skeletal muscle shows low expression as expected.
Immunohistochemistry-Paraffin: PRICKLE1 Antibody [NBP1-83967] - Staining of human cerebral cortex shows high expression.
Orthogonal Strategies: Immunohistochemistry-Paraffin: PRICKLE1 Antibody [NBP1-83967] - Staining in human cerebral cortex and skeletal muscle tissues using anti-PRICKLE1 antibody. Corresponding PRICKLE1 RNA-seq ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

PRICKLE1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GASGYNHDETQWYEDSLECLSDLKPEQSVRDSMDSLALSNITGASVDGENKPRPSLYSLQNFEEMETEDCEKMSNMGTLNSSMLHRSAESLKSLSSELCPEKILPEEKPVHLPVLRRSKSQSRPQQVKFSDDVIDNGNYDIEI
Specificity
Specificity of human PRICKLE1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PRICKLE1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF reactivity per customer review.
Control Peptide
PRICKLE1 Protein (NBP1-83967PEP)
Reviewed Applications
Read 1 Review rated 5
using
NBP1-83967 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PRICKLE1 Antibody

  • EPM1BMGC138902
  • FLJ31627
  • FLJ31937
  • prickle homolog 1 (Drosophila)
  • prickle-like 1 (Drosophila)
  • prickle-like 1
  • prickle-like protein 1
  • REST (RE-1 silencing transcription factor)/NRSF (neuron-restrictive silencerfactor)-interacting LIM domain protein
  • REST/NRSF-interacting LIM domain protein 1
  • RILPMGC138903

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00338382-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NBP1-05048
Species: Hu, Mu, Rt, Bv, Ca, Sh
Applications: WB, ICC/IF
AF4815
Species: Hu, Mu, Rt
Applications: WB, IHC
AF7164
Species: Hu
Applications: WB
NBP1-86990
Species: Hu
Applications: WB, IHC, IHC-P, KD
AF6278
Species: Hu, Mu
Applications: WB
AF1927
Species: Hu
Applications: WB, IP, ICC
NBP1-91991
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24648
Species: Hu, Mu, Rt, Pm
Applications: WB
NBP2-55658
Species: Hu
Applications: ICC/IF
NB100-757
Species: Hu
Applications: WB, IHC, IHC-P
NLS5103
Species: Hu, Bv, Ca
Applications: IHC-P, ICC
NBP1-87177
Species: Hu
Applications: IHC, IHC-P
AF1001
Species: Mu
Applications: IHC
NB120-19294
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PRICKLE1 Antibody (NBP1-83967) (0)

There are no publications for PRICKLE1 Antibody (NBP1-83967).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for PRICKLE1 Antibody (NBP1-83967) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using NBP1-83967:
Filter by Applications
IF
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Immunofluorescence PRICKLE1 NBP1-83967
Enlarge
reviewed by:
Craig Dorrell
IF Human 11/16/2015
View

Summary

ApplicationImmunofluorescence
Sample TestedHuman pancreatic tissue sections
SpeciesHuman
LotR07257

Blocking

Blocking Details5 minutes in 10% donkey serum (in DPBS)

Primary Anitbody

Dilution Ratio1:100 dilution in DPBS

Secondary Antibody

Secondary DescriptionDonkey anti-rabbit IgG, Cy3 conjugated
Secondary Manufacturer Cat#Jackson Immuno 711-166-152
Secondary Concentration1:100 dilution in DPBS

Details

Detection NotesAxioskop 2+ microscope, 200ms exposure (Axioscan software). Negative control: secondary antibody only.
Fixation DetailsFresh tissue was embedded in OCT, cryosectioned (10 micron), and sections were preserved in acetone
Wash Description1x with DPBS

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for PRICKLE1 Antibody (NBP1-83967) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for PRICKLE1 Antibody (NBP1-83967)

Discover related pathways, diseases and genes to PRICKLE1 Antibody (NBP1-83967). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PRICKLE1 Antibody (NBP1-83967)

Discover more about diseases related to PRICKLE1 Antibody (NBP1-83967).
 

Pathways for PRICKLE1 Antibody (NBP1-83967)

View related products by pathway.

PTMs for PRICKLE1 Antibody (NBP1-83967)

Learn more about PTMs related to PRICKLE1 Antibody (NBP1-83967).
 

Research Areas for PRICKLE1 Antibody (NBP1-83967)

Find related products by research area.

Blogs on PRICKLE1

There are no specific blogs for PRICKLE1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Craig Dorrell
11/16/2015
Application: IF
Species: Human

Bioinformatics

Gene Symbol PRICKLE1