PRICKLE1 Antibody

Immunohistochemistry-Paraffin: PRICKLE1 Antibody [NBP1-83967] - Analysis in human cerebral cortex and skeletal muscle tissues. Corresponding PRICKLE1 RNA-seq data are presented for the same tissues.

Immunocytochemistry/Immunofluorescence: PRICKLE1 Antibody [NBP1-83967] - Staining of human pancreatic frozen tissue sections stained with PRICKLE1 antibody (red). Nuclei labeled with DAPI (blue). Image from verified customer review.

Immunohistochemistry-Paraffin: PRICKLE1 Antibody [NBP1-83967] - Staining of human fallopian tube shows weak to moderate nuclear positivity in glanular cells.

Immunohistochemistry-Paraffin: PRICKLE1 Antibody [NBP1-83967] - Staining of human testis shows moderate nuclear postivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: PRICKLE1 Antibody [NBP1-83967] - Staining of human cerebral cortex shows moderate strong nuclear positivity in neurons.

Immunohistochemistry-Paraffin: PRICKLE1 Antibody [NBP1-83967] - Staining of human skeletal muscle shows no postivity in myocytes as expected.

Product Discontinued

PRICKLE1 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: GASGYNHDETQWYEDSLECLSDLKPEQSVRDSMDSLALSNITGASVDGENKPRPSLYSLQNFEEMETEDCEKMSNMGTLNSSMLHRSAESLKSLSSELCPEKILPEEKPVHLPVLRRSKSQSRPQQVKFSDDVIDNGNYDIEI
• Predicted Species: Mouse (91%), Rat (94%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PRICKLE1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. PRICKLE1 antibody validated for ICC/IF from a verified customer review.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PRICKLE1 Antibody

• EPM1BMGC138902
• FLJ31627
• FLJ31937
• prickle homolog 1 (Drosophila)
• prickle-like 1 (Drosophila)
• prickle-like 1
• prickle-like protein 1
• REST (RE-1 silencing transcription factor)/NRSF (neuron-restrictive silencerfactor)-interacting LIM domain protein
• REST/NRSF-interacting LIM domain protein 1
• RILPMGC138903

Background

PRICKLE1 has 831 amino acids and is approximately 94kDa. PRICKLE1 localizes to the nuclear membrane and is involved in the movement of REST, a transcription repressor. PRICKLE1 is implicated in pathways that regulate neural tube development and gastrulation. PRICKLE1 may also be a nuclear receptor that negatively regulates the Wnt/beta-catenin signaling pathway. Current research on PRICKLE1 is being performed in relation to several diseases and disorders including neural tube defects and progressive myoclonic epilepsy type 1B. PRICKLE1 has also been shown to interact with Dishevelled 1, Dishevelled 2, Dishevelled 3, VIP, and SMURF2 in the Wnt signaling pathway.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Review for PRICKLE1 Antibody (NBP1-83967) (1)

Average Rating: 5

(Based on 1 review)

We have 1 review tested in 1 species: Human.

reviewed by: Verified Customer IF Human 11/16/2015

Summary

• Application: Immunofluorescence
• Sample Tested: Human pancreatic tissue sections
• Species: Human
• Lot: R07257

Bioinformatics

• Gene Symbol: PRICKLE1