PRDM7 Antibody

Images

 
Western Blot: PRDM7 Antibody [NBP2-83417] - Host: Rabbit. Target Name: PRDM7. Sample Type: Fetal Lung lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PRDM7 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human PRDM7. Peptide sequence: FIDSCAAHGPPTFVKDSAVDKGHPNRSALSLPPGLRIGPSGIPQAGLGVW The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
PRDM7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PRDM7 Antibody

  • probable histone-lysine N-methyltransferase PRDM7
  • PFM4
  • PR domain containing 7
  • ZNF910

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2605
Species: Hu
Applications: ICC, IHC, Simple Western, WB
314-BP/CF
Species: Hu
Applications: BA, BA
AF3797
Species: Hu, Mu
Applications: ChIP, ICC, IHC, Simple Western, WB
NBP1-33177
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
AF4798
Species: Hu, Mu
Applications: WB
NBP2-16012
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00010362-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-83417
Species: Hu
Applications: WB

Publications for PRDM7 Antibody (NBP2-83417) (0)

There are no publications for PRDM7 Antibody (NBP2-83417).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PRDM7 Antibody (NBP2-83417) (0)

There are no reviews for PRDM7 Antibody (NBP2-83417). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PRDM7 Antibody (NBP2-83417) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PRDM7 Products

Bioinformatics Tool for PRDM7 Antibody (NBP2-83417)

Discover related pathways, diseases and genes to PRDM7 Antibody (NBP2-83417). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PRDM7 Antibody (NBP2-83417)

Discover more about diseases related to PRDM7 Antibody (NBP2-83417).
 

Pathways for PRDM7 Antibody (NBP2-83417)

View related products by pathway.

Blogs on PRDM7

There are no specific blogs for PRDM7, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PRDM7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PRDM7