We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

PRAF1 Recombinant Protein Antigen

Images

 
There are currently no images for PRAF1 Recombinant Protein Antigen (NBP2-56173PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

PRAF1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PRAF1.

Source: E. coli

Amino Acid Sequence: LPPCYDDAAKPEDVYKFEDLLSPAEYEALQSPSEAFRNVTSEEILKMIEENSHCTFVIEALKSLPSDVESRDRQARCIWFLDTLIKFRAHRVVKRKSALGP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
POLR1E
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56173.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PRAF1 Recombinant Protein Antigen

  • DNA-directed RNA polymerase I subunit E
  • DNA-directed RNA polymerase I subunit RPA49
  • FLJ13390
  • FLJ13970
  • FLJ43482
  • PAF53RNA polymerase I-associated factor 1
  • polymerase (RNA) I associated factor 1
  • polymerase (RNA) I polypeptide E, 53kDa
  • PRAF1
  • RNA polymerase I associated factor 53
  • RNA polymerase I subunit A49
  • RNA polymerase I-associated factor 53
  • RP11-405L18.3

Background

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleosidetriphosphates as substrates. Component of RNA polymerase I which synthesizes ribosomal RNA precursors. Appears to beinvolved in the formation of the initiation complex at the promoter by mediating the interaction between Pol I andUBTF/UBF

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-82545
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP3-12158
Species: Hu
Applications: Flow, ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
NBP2-19676
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB110-61646
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP1-87886
Species: Hu, Rt
Applications: IHC,  IHC-P, WB
NBP1-80883
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-38210
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-16686
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KO, WB
NB300-269
Species: Bv, Ce, Ch, Dr, Eq, Hu, Mu, Pl, Po, Rt, Y, Ye
Applications: Flow, ICC/IF, IHC-WhMt, IHC, IHC-Fr,  IHC-P, KD, WB
NBP2-38206
Species: Hu
Applications: IHC,  IHC-P, KD, WB
NBP2-47609
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC,  IHC-P
NBP3-45895
Species: Hu, Mu
Applications: ELISA, IHC, WB
NBP1-82455
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF,  IHC-P, WB
MAB6495
Species: Hu
Applications: ICC, Simple Western, WB
NBP1-23017
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, KD, Simple Western, WB
NB100-1533
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
NBP2-58841
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC

Publications for PRAF1 Recombinant Protein Antigen (NBP2-56173PEP) (0)

There are no publications for PRAF1 Recombinant Protein Antigen (NBP2-56173PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PRAF1 Recombinant Protein Antigen (NBP2-56173PEP) (0)

There are no reviews for PRAF1 Recombinant Protein Antigen (NBP2-56173PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PRAF1 Recombinant Protein Antigen (NBP2-56173PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PRAF1 Products

Blogs on PRAF1

There are no specific blogs for PRAF1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PRAF1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol POLR1E