Recombinant Human PRA1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human PRA1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 28126 of Human RABAC1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MAAQKDQQKDAEAEGLSGTTLLPKLIPSGAGREWLERRRATIRPWSTFVDQQRFSRPRNLGELCQRLVRNVEYYQSN

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
RABAC1
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PRA1 Protein

  • PRA1 family protein 1
  • PRA1PRA1 domain family 1
  • PRAF1prenylated Rab acceptor 1
  • prenylated Rab acceptor protein 1
  • Rab acceptor 1 (prenylated)
  • YIP3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1105
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
NB300-595
Species: Mu, Rt, Bv
Applications: WB, Flow, IHC, IHC-P, IP, IF
NBP1-87886
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-91991
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31528
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB120-3335
Species: Hu, Mu, Rt, Ca
Applications: WB, Flow, ICC/IF, IP
NBP2-45745
Species: Hu
Applications: WB, IHC, IF
NBP1-84841
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-26380
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF4779
Species: Hu
Applications: WB, IHC
MAB6534
Species: Hu
Applications: WB, ELISA
NBP1-33110
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB200-610
Species: Hu, Ca, GP
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP
NB110-89474
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-55113
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB120-13253
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00010567-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for PRA1 Partial Recombinant Protein (H00010567-Q01) (0)

There are no publications for PRA1 Partial Recombinant Protein (H00010567-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PRA1 Partial Recombinant Protein (H00010567-Q01) (0)

There are no reviews for PRA1 Partial Recombinant Protein (H00010567-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PRA1 Partial Recombinant Protein (H00010567-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PRA1 Products

Bioinformatics Tool for PRA1 Partial Recombinant Protein (H00010567-Q01)

Discover related pathways, diseases and genes to PRA1 Partial Recombinant Protein (H00010567-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PRA1 Partial Recombinant Protein (H00010567-Q01)

Discover more about diseases related to PRA1 Partial Recombinant Protein (H00010567-Q01).
 

Pathways for PRA1 Partial Recombinant Protein (H00010567-Q01)

View related products by pathway.

PTMs for PRA1 Partial Recombinant Protein (H00010567-Q01)

Learn more about PTMs related to PRA1 Partial Recombinant Protein (H00010567-Q01).

Blogs on PRA1

There are no specific blogs for PRA1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

CD11b Antibody
NB110-89474
PRA1 Antibody
NBP1-80883
Rab5a Antibody
NB120-13253

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PRA1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RABAC1