PQBP1 Recombinant Protein Antigen

Images

 
There are currently no images for PQBP1 Protein (NBP1-82619PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

PQBP1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PQBP1.

Source: E. coli

Amino Acid Sequence: PVALQTRLAKRGILKHLEPEPEEEIIAEDYDDDPVDYEATRLEGLPPSWYKVFDPSCGLPYYWNADTDLVSWLSPHDPNSVVTKSAKKLRSSNADAEEKLDRSHDKSDRGHDKSDRSHEKLDRGHDKSDRGHDKSDRDRERGYDKVD

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PQBP1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-82619.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
35 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PQBP1 Recombinant Protein Antigen

  • 38 kDa nuclear protein containing a WW domain
  • MRX55
  • MRXS3
  • MRXS8
  • Npw38
  • NPW38mental retardation, X-linked 55
  • nuclear protein containing WW domain 38 kD
  • polyglutamine binding protein 1
  • Polyglutamine tract-binding protein 1
  • polyglutamine-binding protein 1
  • PQBP-1
  • RENS1
  • SHS
  • Sutherland-Haan X-linked mental retardation syndrome

Background

PQBP1, also known as Polyglutamine-binding protein 1, is a nuclear polyglutamine-binding protein that may play a role in apoptosis and DNA replication. Ten isoforms of PQBP1 have been identified which are produced by alternative splicing. The canonical sequence, referred to as PQBP-1, is 265 amino acids long and approximately 30kdA. PQBP1 may be implicated in an x-linked mental retardation syndrome called Renpenning syndrome 1 (RENS1), as well as neurodegenerative diseases, coloboma, spastic diplegia, ataxia and neuronitis. PQBP1 has also been shown to interact with C14orf1, MED31, WBP11, CLTB, and SF3A2.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00001487-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, S-ELISA, WB
NBP2-04611
Species: Hu
Applications: WB
DY1707
Species: Hu
Applications: ELISA
M6000B
Species: Mu
Applications: ELISA
NBP2-20886
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NBP1-87691
Species: Hu
Applications: IHC,  IHC-P, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
AF5739
Species: Hu, Mu, Rt
Applications: WB
NBP3-15642
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-51689
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
MAB4540
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
AF630
Species: Hu
Applications: IHC, Neut, WB
H00010907-M01
Species: Hu
Applications: ELISA, S-ELISA, WB
NBP1-91991
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NBP1-82619PEP
Species: Hu
Applications: AC

Publications for PQBP1 Protein (NBP1-82619PEP) (0)

There are no publications for PQBP1 Protein (NBP1-82619PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PQBP1 Protein (NBP1-82619PEP) (0)

There are no reviews for PQBP1 Protein (NBP1-82619PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PQBP1 Protein (NBP1-82619PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PQBP1 Products

Research Areas for PQBP1 Protein (NBP1-82619PEP)

Find related products by research area.

Blogs on PQBP1

There are no specific blogs for PQBP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PQBP1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PQBP1