PPP3R2 Antibody - Azide and BSA Free

Western Blot: PPP3R2 Antibody [H00005535-D01P] - Analysis of PPP3R2 expression in transfected 293T cell line by PPP3R2 polyclonal antibody.Lane 1: PPP3R2 transfected lysate(19.90 KDa).Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

PPP3R2 Antibody - Azide and BSA Free Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: PPP3R2 (NP_671709.1, 1 a.a. - 173 a.a.) full-length human protein. MSTMGNEASYPAEMCSHFDNDEIKRLGRRFKKLDLDKSGSLSVEEFMSLPELRHNPLVRRVIDVFDTDGDGEVDFKEFILGTSQFSVKGDEEQKLRFAFSIYDMDKDGYISNGELFQVLKMMVGNNLTDWQLQQLVDKTIIILDKDGDGKISFEEFSAVVRDLEIHKKLVLIV
• Specificity: Reacts with protein phosphatase 3 (formerly 2B), regulatory subunit B, beta isoform.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PPP3R2
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot
• Application Notes: This antibody is reactive against transfected lysate in WB and as a detection antibody in ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PPP3R2 Antibody - Azide and BSA Free

• calcineurin B, type II (19kDa)
• Calcineurin BII
• Calcineurin B-like protein
• calcineurin subunit B type 2
• CBLP
• CNBII
• PPP3R1-like
• PPP3R2
• PPP3RL
• Protein phosphatase 2B regulatory subunit 2
• protein phosphatase 3 (formerly 2B), regulatory subunit B (19kD), beta isoform(calcineurin B, type II)
• protein phosphatase 3 (formerly 2B), regulatory subunit B, 19kDa, beta isoform(calcineurin B, type II)
• protein phosphatase 3 (formerly 2B), regulatory subunit B, beta isoform
• Protein phosphatase 3 regulatory subunit B beta isoform
• protein phosphatase 3, regulatory subunit B, beta

Background

PPP3R2 also known as Calcineurin subunit B type 2, is a 170 amino acid protein that is 20 kDa, is testis-specific, is a regulatory subunit of calcineurin, a calcium-dependent, calmodulin stimulated protein phosphatase, and confers calcium sensitivity. This protein is being studied for its involvement in amyotrophic lateral sclerosis (als), amyotrophic lateral sclerosis, lateral sclerosis, tuberculosis, malaria, and neuronitis. PPP3R2 protein is involved is several pathways including MAPK signaling pathway, Alzheimer's Disease, Energy Metabolism, Calcium signaling pathway, Oocyte meiosis, Apoptosis, Wnt signaling pathway, Tacrolimus/Cyclosporine Pathway, Pharmacodynamics, 14-3-3 Induced Apoptosis, Intracellular Calcium Signaling, PI3K Signaling in B-Lymphocyte, IL-2 Pathway, and ITK and TCR Signaling Pathway where it interacts with TBC1D10C, PLCG1, PLCG2, ANAPC1, ANAPC10, and approx. 30 other proteins.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PPP3R2
• Entrez:
  • 5535(Human)
• Uniprot:
  • NP_671709.1(Human)