PPP2R5D Antibody (1A3) - Azide and BSA Free

Western Blot: PPP2R5D Antibody (1A3) [H00005528-M21] - Analysis of PPP2R5D expression in Jurkat (Cat # L017V1).

Immunocytochemistry/Immunofluorescence: PPP2R5D Antibody (1A3) [H00005528-M21] - Analysis of monoclonal antibody to PPP2R5D on HeLa cell. Antibody concentration 10 ug/ml

Sandwich ELISA: PPP2R5D Antibody (1A3) [H00005528-M21] - Detection limit for recombinant GST tagged PPP2R5D is 0.3 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, ICC/IF
• Clone: 1A3
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

PPP2R5D Antibody (1A3) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: PPP2R5D (NP_006236.1, 514 a.a. ~ 602 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RLNPQYPMFRAPPPLPPVYSMETETPTAEDIQLLKRTVETEAVQMLKDIKKEKVLLRRKSELPQDVYTIKALEAHKRAEEFLTASQEAL
• Specificity: PPP2R5D - protein phosphatase 2, regulatory subunit B (B56), delta isoform (1A3)
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: PPP2R5D
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PPP2R5D Antibody (1A3) - Azide and BSA Free

• MGC2134
• MGC8949
• PP2A B subunit isoform B56-delta
• PP2A B subunit isoform B'-delta
• PP2A B subunit isoform PR61-delta
• PP2A B subunit isoform R5-delta
• PP2A, B subunit, B' delta isoform
• PP2A, B subunit, B56 delta isoform
• PP2A, B subunit, PR61 delta isoform
• PP2A, B subunit, R5 delta isoform
• protein phosphatase 2, regulatory subunit B', delta
• regulatory subunit B (B56), delta isoform
• regulatory subunit B', delta isoform
• Serine/threonine protein phosphatase 2A, 56 kDa regulatory subunit, deltaisoform
• serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit delta isoform

Background

The product of this gene belongs to the phosphatase 2A regulatory subunit B family. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The B regulatory subunit might modulate substrate selectivity and catalytic activity. This gene encodes a delta isoform of the regulatory subunit B56 subfamily. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PPP2R5D
• Entrez:
  • 5528(Human)
• Uniprot:
  • NP_006236(Human)