PPP2R5D Antibody (1A3)

Images

 
Western Blot: PPP2R5D Antibody (1A3) [H00005528-M21] - Analysis of PPP2R5D expression in Jurkat (Cat # L017V1).
Immunocytochemistry/ Immunofluorescence: PPP2R5D Antibody (1A3) [H00005528-M21] - Analysis of monoclonal antibody to PPP2R5D on HeLa cell. Antibody concentration 10 ug/ml
Sandwich ELISA: PPP2R5D Antibody (1A3) [H00005528-M21] - Detection limit for recombinant GST tagged PPP2R5D is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
1A3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

PPP2R5D Antibody (1A3) Summary

Immunogen
PPP2R5D (NP_006236.1 514 a.a. - 602 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RLNPQYPMFRAPPPLPPVYSMETETPTAEDIQLLKRTVETEAVQMLKDIKKEKVLLRRKSELPQDVYTIKALEAHKRAEEFLTASQEAL
Specificity
PPP2R5D - protein phosphatase 2, regulatory subunit B (B56), delta isoform (1A3)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PPP2R5D
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PPP2R5D Antibody (1A3)

  • MGC2134
  • MGC8949
  • PP2A B subunit isoform B56-delta
  • PP2A B subunit isoform B'-delta
  • PP2A B subunit isoform PR61-delta
  • PP2A B subunit isoform R5-delta
  • PP2A, B subunit, B' delta isoform
  • PP2A, B subunit, B56 delta isoform
  • PP2A, B subunit, PR61 delta isoform
  • PP2A, B subunit, R5 delta isoform
  • protein phosphatase 2, regulatory subunit B', delta
  • regulatory subunit B (B56), delta isoform
  • regulatory subunit B', delta isoform
  • Serine/threonine protein phosphatase 2A, 56 kDa regulatory subunit, deltaisoform
  • serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit delta isoform

Background

The product of this gene belongs to the phosphatase 2A regulatory subunit B family. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The B regulatory subunit might modulate substrate selectivity and catalytic activity. This gene encodes a delta isoform of the regulatory subunit B56 subfamily. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87232
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-25162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-81245
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85196
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15843
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP1-33402
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91952
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14225
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-47470
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
NBP2-45570
Species: Hu
Applications: WB, Flow, IHC
NBP2-00594
Species: Hu
Applications: WB, Flow, IHC, IHC-P
AF4429
Species: Mu
Applications: WB
AF6526
Species: Hu
Applications: WB
NBP2-22523
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PPP2R5D Antibody (H00005528-M21) (0)

There are no publications for PPP2R5D Antibody (H00005528-M21).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PPP2R5D Antibody (H00005528-M21) (0)

There are no reviews for PPP2R5D Antibody (H00005528-M21). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PPP2R5D Antibody (H00005528-M21) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PPP2R5D Products

Bioinformatics Tool for PPP2R5D Antibody (H00005528-M21)

Discover related pathways, diseases and genes to PPP2R5D Antibody (H00005528-M21). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PPP2R5D Antibody (H00005528-M21)

Discover more about diseases related to PPP2R5D Antibody (H00005528-M21).
 

Pathways for PPP2R5D Antibody (H00005528-M21)

View related products by pathway.

PTMs for PPP2R5D Antibody (H00005528-M21)

Learn more about PTMs related to PPP2R5D Antibody (H00005528-M21).
 

Research Areas for PPP2R5D Antibody (H00005528-M21)

Find related products by research area.

Blogs on PPP2R5D

There are no specific blogs for PPP2R5D, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PPP2R5D Antibody (1A3) and receive a gift card or discount.

Bioinformatics

Gene Symbol PPP2R5D
Entrez
Uniprot