PPP2R2D Recombinant Protein Antigen

Images

 
There are currently no images for PPP2R2D Protein (NBP2-33379PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

PPP2R2D Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PPP2R2D.

Source: E.coli

Amino Acid Sequence: FEEPEDPSSRSFFSEIISSISDVKFSHSGRYM

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PPP2R2D
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-33379.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for PPP2R2D Recombinant Protein Antigen

  • KIAA1541
  • MDS026
  • PP2A subunit B isoform B55-delta
  • PP2A subunit B isoform delta
  • PP2A subunit B isoform PR55-delta
  • PP2A subunit B isoform R2-delta
  • protein phosphatase 2, regulatory subunit B, delta isoform
  • protein phosphatase 2, regulatory subunit B, delta
  • serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B deltaisoform

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-93798
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-37530
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NB100-104
Species: Hu, Mu, Rt, Ca, Ma
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
NB100-56599
Species: Hu, Mu, Rt(-)
Applications: WB, Flow, ICC/IF, Flow-IC
AF3025
Species: Hu
Applications: WB, ELISA, ICC
NBP2-43728
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB100-404
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, KD
NB300-155
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
AF3797
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, ICC
AF222
Species: Hu
Applications: WB, Block, KO
NB100-148
Species: Hu, Mu, Rt, Ce, Ch
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, PLA, KD
NB100-847
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NB100-56546
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-89907
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-33379PEP
Species: Hu
Applications: AC

Publications for PPP2R2D Protein (NBP2-33379PEP) (0)

There are no publications for PPP2R2D Protein (NBP2-33379PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PPP2R2D Protein (NBP2-33379PEP) (0)

There are no reviews for PPP2R2D Protein (NBP2-33379PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PPP2R2D Protein (NBP2-33379PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional PPP2R2D Products

Bioinformatics Tool for PPP2R2D Protein (NBP2-33379PEP)

Discover related pathways, diseases and genes to PPP2R2D Protein (NBP2-33379PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PPP2R2D Protein (NBP2-33379PEP)

Discover more about diseases related to PPP2R2D Protein (NBP2-33379PEP).
 

Pathways for PPP2R2D Protein (NBP2-33379PEP)

View related products by pathway.

PTMs for PPP2R2D Protein (NBP2-33379PEP)

Learn more about PTMs related to PPP2R2D Protein (NBP2-33379PEP).
 

Research Areas for PPP2R2D Protein (NBP2-33379PEP)

Find related products by research area.

Blogs on PPP2R2D

There are no specific blogs for PPP2R2D, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ATM Antibody
NB100-104

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PPP2R2D Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PPP2R2D