PPP1R16B Recombinant Protein Antigen

Images

 
There are currently no images for PPP1R16B Recombinant Protein Antigen (NBP3-17296PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

PPP1R16B Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PPP1R16B

Source: E. coli

Amino Acid Sequence: RASLSDRTNLYRKEYEGEAILWQRSAAEDQRTSTYNGDIRETRTDQENKDPNPRLEKPVLLSEFPTKI

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PPP1R16B
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17296.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PPP1R16B Recombinant Protein Antigen

  • ANKRD4TIMAPankyrin repeat domain protein 4
  • Ankyrin repeat domain-containing protein 4
  • CAAX box protein TIMAP
  • hTIMAP
  • KIAA0823TGF-beta-inhibited membrane-associated protein
  • protein phosphatase 1 regulatory inhibitor subunit 16B
  • protein phosphatase 1, regulatory (inhibitor) subunit 16B

Background

PPP1R16B is encoded by this gene is membrane-associated and contains five ankyrin repeats, a protein phosphatase-1-interacting domain, and a carboxy-terminal CAAX box domain. Synthesis of the encoded protein is inhibited by transforming growth factor beta-1. The protein may bind to the membrane through its CAAX box domain and may act as a signaling molecule through interaction with protein phosphatase-1. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-35077
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IP, WB
NBP1-31348
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
H00084988-B01P
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-37897
Species: Hu
Applications: IHC,  IHC-P, Simple Western, WB
NBP1-81838
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-32875
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP1-32858
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
7754-BH/CF
Species: Hu
Applications: BA
NBP1-87751
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-79854
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IHC,  IHC-P, PA, WB
NBP1-47470
Species: Hu, Mu, Pm, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, Simple Western, WB
H00005962-M06
Species: Ch, Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB
NB100-91273
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-12487
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB
5396-SF
Species: Hu
Applications: BA
NBP3-17296PEP
Species: Hu
Applications: AC

Publications for PPP1R16B Recombinant Protein Antigen (NBP3-17296PEP) (0)

There are no publications for PPP1R16B Recombinant Protein Antigen (NBP3-17296PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PPP1R16B Recombinant Protein Antigen (NBP3-17296PEP) (0)

There are no reviews for PPP1R16B Recombinant Protein Antigen (NBP3-17296PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PPP1R16B Recombinant Protein Antigen (NBP3-17296PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PPP1R16B Products

Blogs on PPP1R16B

There are no specific blogs for PPP1R16B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PPP1R16B Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PPP1R16B