PPME1 Antibody - BSA Free

Western Blot: PPME1 Antibody [NBP2-38515] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human cell line CACO-2

Immunohistochemistry-Paraffin: PPME1 Antibody [NBP2-38515] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.

Simple Western: PPME1 Antibody [NBP2-38515] - Simple Western lane view shows a specific band for PPME1 in 0.2 mg/ml of HT-29 (left) and HCT 116 (right) lysate(s). This experiment was performed under reducing conditions using the 12-230 kDa separation systems.

Simple Western: PPME1 Antibody [NBP2-38515] - Electropherogram image of the corresponding Simple Western lane view. PPME1 antibody was used at 1:25 dilution on HT-29 and HCT 116 lysate(s) respectively.

• Reactivity: Hu, Mu, Rt
• Applications: WB, Simple Western, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PPME1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PPME1 Antibody - BSA Free (NBP2-38515) is a polyclonal antibody validated for use in IHC, WB and Simple Western. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: PPLPGSGGSQSGAKMRMGPGRKRDFSPVPWSQYFESMEDVEVENETGKDTFRVYKSGSEGPVLLLLHGGG
• Predicted Species: Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PPME1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Simple Western 1:25
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Simple Western: PPME1 antibody was used at 1:25 dilution.
  See Simple Western Antibody Database for Simple Western validation: Tested in HT-29 and HCT 116 lysates, separated by Size, antibody dilution of 1:25
• Control Peptide:

  PPME1 Protein (NBP2-38515PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for PPME1 Antibody - BSA Free

• EC 3.1.1
• EC 3.1.1.-
• FLJ22226
• PME-1PME1
• protein phosphatase methylesterase 1
• protein phosphatase methylesterase-1

Background

Protein phosphatase methylesterase-1 catalyzes the demethylation of the protein phosphatase-2A catalytic subunit (PPP2CA; MIM 176915) (Ogris et al., 1999 [PubMed 10318862]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PPME1
• Uniprot:
  • Q9Y570(Human)