PPME1 Antibody

Images

 
Western Blot: PPME1 Antibody [NBP2-38515] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human cell line CACO-2
Immunohistochemistry-Paraffin: PPME1 Antibody [NBP2-38515] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.
Simple Western: PPME1 Antibody [NBP2-38515] - Simple Western lane view shows a specific band for PPME1 in 0.2 mg/ml of HT-29 (left) and HCT 116 (right) lysate(s). This experiment was performed under reducing conditions ...read more
Simple Western: PPME1 Antibody [NBP2-38515] - Electropherogram image of the corresponding Simple Western lane view. PPME1 antibody was used at 1:25 dilution on HT-29 and HCT 116 lysate(s) respectively.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, Simple Western, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PPME1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: PPLPGSGGSQSGAKMRMGPGRKRDFSPVPWSQYFESMEDVEVENETGKDTFRVYKSGSEGPVLLLLHGGG
Specificity
Specificity of human PPME1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PPME1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Simple Western 1:25
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PPME1 Protein (NBP2-38515PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PPME1 Antibody

  • EC 3.1.1
  • EC 3.1.1.-
  • FLJ22226
  • PME-1PME1
  • protein phosphatase methylesterase 1
  • protein phosphatase methylesterase-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37530
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
NBP2-00923
Species: Hu, Mu, Rt, Pm
Applications: WB, IHC, IHC-P
AF5414
Species: Hu
Applications: WB, Simple Western
AF1408
Species: Hu, Rt
Applications: WB, Simple Western, IHC, IP
NBP1-62489
Species: Hu
Applications: WB
NBP2-25162
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
NBP2-27335
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-31266
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-58707
Species: Hu
Applications: WB, ICC/IF
NBP1-87799
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB8164
Species: Hu
Applications: Flow, IHC, CyTOF-ready, ICC
NBP1-90149
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-31348
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-43728
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-90078
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56888
Species: Hu, Mu, Rt, Ca, Eq
Applications: WB
NBP2-02269
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-38515
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P

Publications for PPME1 Antibody (NBP2-38515) (0)

There are no publications for PPME1 Antibody (NBP2-38515).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PPME1 Antibody (NBP2-38515) (0)

There are no reviews for PPME1 Antibody (NBP2-38515). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PPME1 Antibody (NBP2-38515) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for PPME1 Antibody (NBP2-38515)

Discover related pathways, diseases and genes to PPME1 Antibody (NBP2-38515). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PPME1 Antibody (NBP2-38515)

Discover more about diseases related to PPME1 Antibody (NBP2-38515).
 

Pathways for PPME1 Antibody (NBP2-38515)

View related products by pathway.

PTMs for PPME1 Antibody (NBP2-38515)

Learn more about PTMs related to PPME1 Antibody (NBP2-38515).
 

Research Areas for PPME1 Antibody (NBP2-38515)

Find related products by research area.

Blogs on PPME1

There are no specific blogs for PPME1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PPME1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PPME1
Uniprot