PPM1D Recombinant Protein Antigen

Images

 
There are currently no images for PPM1D Protein (NBP1-87249PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

PPM1D Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PPM1D.

Source: E. coli

Amino Acid Sequence: KHKYIILGSDGLWNMIPPQDAISMCQDQEEKKYLMGEHGQSCAKMLVNRALGRWRQRMLRADNTSAIVICISPEVDNQGNFTNEDELYLNLT

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PPM1D
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87249.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PPM1D Recombinant Protein Antigen

  • EC 3.1.3.16
  • p53-induced protein phosphatase 1
  • PP2C-delta
  • PPM1D
  • protein phosphatase 1D magnesium-dependent, delta isoform
  • protein phosphatase 1D
  • protein phosphatase 2C delta isoform
  • Protein phosphatase 2C isoform delta
  • Protein phosphatase magnesium-dependent 1 delta
  • protein phosphatase, Mg2+/Mn2+ dependent, 1D
  • wild-type p53-induced phosphatase 1
  • Wip1
  • WIP1protein phosphatase Wip1

Background

PPM1D is encoded by this gene is a member of the PP2C family of Ser/Thr protein phosphatases. PP2C family members are known to be negative regulators of cell stress response pathways. The expression of this gene is induced in a p53-dependent manner in response to various environmental stresses. While being induced by tumor suppressor protein TP53/p53, this phosphatase negatively regulates the activity of p38 MAP kinase, MAPK/p38, through which it reduces the phosphorylation of p53, and in turn suppresses p53-mediated transcription and apoptosis. This phosphatase thus mediates a feedback regulation of p38-p53 signaling that contributes to growth inhibition and the suppression of stress induced apoptosis. This gene is located in a chromosomal region known to be amplified in breast cancer. The amplification of this gene has been detected in both breast cancer cell line and primary breast tumors, which suggests a role of this gene in cancer development.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NB100-309
Species: Hu, Pm, Mu, Rt
Applications: ChIP, ELISA, Flow, ICC/IF, IHC,  IHC-P, IP, KD, PAGE, Single-Cell Western, WB
NBP2-71688
Species: Ca, Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC,  IHC-P, IP, WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NB100-464
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, WB
AF8691
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
NB100-308
Species: Hu, Mu
Applications: Func, ICC/IF, IP, In vitro, KO, WB
NBP2-03417
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
NB100-56585
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
AF1244
Species: Hu, Mu, Rt
Applications: IHC, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NBP2-13304
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
1129-ER
Species: Hu
Applications: BA
NBP2-37568
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-00764
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB

Publications for PPM1D Protein (NBP1-87249PEP) (0)

There are no publications for PPM1D Protein (NBP1-87249PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PPM1D Protein (NBP1-87249PEP) (0)

There are no reviews for PPM1D Protein (NBP1-87249PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PPM1D Protein (NBP1-87249PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PPM1D Products

Array NBP1-87249PEP

Research Areas for PPM1D Protein (NBP1-87249PEP)

Find related products by research area.

Blogs on PPM1D

There are no specific blogs for PPM1D, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PPM1D Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PPM1D