PPIG Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

PPIG Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PPIG.
  
  

  Source: E. coli

  Amino Acid Sequence: QRMRVSSGERWIKGDKSELNEIKENQRSPVRVKERKITDHRNVSESPNRKNEKEKKVKDHKSNSKERDIRRNSEKEDKYKNKVKKRAKSKS

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: PPIG
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-49256.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 29 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PPIG Recombinant Protein Antigen

• CARS-cyclophilin
• CARS-CypPPIase G
• CASP10
• Clk-associating RS-cyclophilin
• Cyclophilin G
• CYP
• EC 5.2.1.8
• MGC133241
• peptidyl-prolyl cis-trans isomerase G
• peptidylprolyl isomerase G (cyclophilin G)
• peptidyl-prolyl isomerase G (cyclophilin G)
• Peptidyl-prolyl isomerase G
• Rotamase G
• SCAF10
• SR-cyclophilin
• SRCyp
• SR-cyp
• SR-related CTD-associated factor 10

Background

SR cyclophilin (SRcyp) is also known as peptidyl-prolyl cis-trans isomerase G. Cyclophilins are peptidyl-prolyl isomerases (PPIases) that accelerate the folding of proteins by catalyzing the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. The function of cyclophilins is poorly understood, but their function has been linked to multiple cellular processes such as protein folding, trafficking, and chaperone activity. SRcyp is a member of the Moca family of nuclear cyclophilins and is phosphorylated in a cell cycle dependent manner. There is evidence that SRcyp may be involved in the regulation of gene expression and mRNA splicing. Alternative names for SRcyp include PPIase G, rotamase G, cyclophilin G, clk-associating RS-cyclophilin, CARS-cyclophilin, SR-cyp, CASP10, and PPIG.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: PPIG