Recombinant Human PPFIA3 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human PPFIA3 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1043-1139 of Human PPFIA3 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:NERVMGWVSGLGLKEFATNLTESGVHGALLALDETFDYSDLALLLQIPTQNAQARQLLEKEFSNLISLGTDRRLDEDSAKSFSRSPSWRKMFREKDL

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
PPFIA3
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PPFIA3 Protein

  • KIAA0654liprin
  • liprin-alpha-3
  • LPNA3liprin-alpha 3
  • MGC126567
  • MGC126569
  • Protein tyrosine phosphatase receptor type f polypeptide-interacting proteinalpha-3
  • protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interactingprotein (liprin), alpha 3
  • protein tyrosine phosphatase, receptor type, f polypeptide, alpha 3
  • PTPRF-interacting protein alpha-3

Background

PPFIA3 - protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interacting protein (liprin), alpha 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

21720002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-42172
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, ICC
NBP2-41211
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IF
NBP2-15018
Species: Mu
Applications: WB
H00085329-T01
Species: Hu
H00051147-B01P
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P
NBP2-31560
Species: Hu
Applications: IHC, IHC-P
NBP1-83192
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1756
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-56929
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-19775
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-79810
Species: Hu, Mu
Applications: WB, ICC/IF, IP, PLA
AF1320
Species: Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-88911
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NLS6792
Species: Hu, Mu, Po, Bt, Bv, Ca, Eq, Ha, Mk, Pm, Rb
Applications: IHC-P
1849-NK
Species: Hu
NBP1-87425
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92335
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00008541-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for PPFIA3 Partial Recombinant Protein (H00008541-Q01) (0)

There are no publications for PPFIA3 Partial Recombinant Protein (H00008541-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PPFIA3 Partial Recombinant Protein (H00008541-Q01) (0)

There are no reviews for PPFIA3 Partial Recombinant Protein (H00008541-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PPFIA3 Partial Recombinant Protein (H00008541-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PPFIA3 Products

Bioinformatics Tool for PPFIA3 Partial Recombinant Protein (H00008541-Q01)

Discover related pathways, diseases and genes to PPFIA3 Partial Recombinant Protein (H00008541-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for PPFIA3 Partial Recombinant Protein (H00008541-Q01)

View related products by pathway.

Research Areas for PPFIA3 Partial Recombinant Protein (H00008541-Q01)

Find related products by research area.

Blogs on PPFIA3

There are no specific blogs for PPFIA3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

PPFIA3 Antibody
NBP2-30453

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PPFIA3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PPFIA3