PPAPDC1A Antibody

Images

 
Western Blot: PPAPDC1A Antibody [NBP2-14545] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: PPAPDC1A Antibody [NBP2-14545] - Staining of human cell line A-431 shows localization to nucleus & nucleoli.
Immunohistochemistry-Paraffin: PPAPDC1A Antibody [NBP2-14545] - Staining of human cerebral cortex shows moderate nucleolar positivity in neuronal cells, neuropil was strongly stained.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PPAPDC1A Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: RQHYPPLANTACHKPYVSLRVPASLKKEERPTADSAPSLPLEGITEGPV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PPAPDC1A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PPAPDC1A Protein (NBP2-14545PEP)
Publications
Read Publication using
NBP2-14545 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PPAPDC1A Antibody

  • DPPL2
  • PPAPDC1
  • PPAPDC1A phosphatidic acid phosphatase type 2 domain containing 1A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-52501
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, IF
NBP2-24763
Species: Hu, Pm
Applications: WB, IHC-P
H00023213-D01P
Species: Hu
Applications: WB, ELISA
NBP2-38621
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-55527
Species: Hu
Applications: ICC/IF
NBP2-07799
Species: Hu
H00005554-R02
Species: Hu
NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P
H00002038-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-01763
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
NBP1-77933
Species: Hu, Mu, Rt, Bv, Ca, Ch, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-61050
Species: Hu
Applications: WB, IHC-P, IP, PLA
MAB6240
Species: Hu
Applications: WB, IHC
NBP2-37477
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
NBP2-45378
Species: Hu
Applications: WB, IHC
AF1034
Species: Mu, Rt
Applications: WB, Simple Western, IHC
NBP1-36999
Species: Hu, Mu, Rt
Applications: PEP-ELISA
NBP1-87343
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP2-24614
Species: Hu, Mu, Rt, Op, Pm
Applications: WB
NBP2-14545
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PPAPDC1A Antibody (NBP2-14545)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC-P.


Filter By Application
IHC-P
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for PPAPDC1A Antibody (NBP2-14545) (0)

There are no reviews for PPAPDC1A Antibody (NBP2-14545). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PPAPDC1A Antibody (NBP2-14545) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PPAPDC1A Products

PPAPDC1A NBP2-14545

Bioinformatics Tool for PPAPDC1A Antibody (NBP2-14545)

Discover related pathways, diseases and genes to PPAPDC1A Antibody (NBP2-14545). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PPAPDC1A Antibody (NBP2-14545)

Discover more about diseases related to PPAPDC1A Antibody (NBP2-14545).

Blogs on PPAPDC1A

There are no specific blogs for PPAPDC1A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PPAPDC1A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PPAPDC1A