PPAPDC1A Antibody

Product Discontinued

PPAPDC1A Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: RQHYPPLANTACHKPYVSLRVPASLKKEERPTADSAPSLPLEGITEGPV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PPAPDC1A
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation/Permeabilization: PFA/Triton X-100

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PPAPDC1A Antibody

• DPPL2
• PPAPDC1
• PPAPDC1A phosphatidic acid phosphatase type 2 domain containing 1A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PPAPDC1A Antibody (NBP2-14545)(1)

Publication using NBP2-14545

• Zhang X, Zhang L, Lin B et al. Phospholipid Phosphatase 4 promotes proliferation and tumorigenesis, and activates Ca(2+)-permeable Cationic Channel in lung carcinoma cells Mol. Cancer 2017-08-29 [PMID: 28851360] (IHC-P, Human)

Bioinformatics

• Gene Symbol: PPAPDC1A