PPAPDC1A Antibody


Western Blot: PPAPDC1A Antibody [NBP2-14545] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: PPAPDC1A Antibody [NBP2-14545] - Staining of human cell line A-431 shows localization to nucleus & nucleoli.
Immunohistochemistry-Paraffin: PPAPDC1A Antibody [NBP2-14545] - Staining of human cerebral cortex shows moderate nucleolar positivity in neuronal cells, neuropil was strongly stained.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

PPAPDC1A Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: RQHYPPLANTACHKPYVSLRVPASLKKEERPTADSAPSLPLEGITEGPV
Specificity of human PPAPDC1A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PPAPDC1A Protein (NBP2-14545PEP)
Read Publication using
NBP2-14545 in the following applications:

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for PPAPDC1A Antibody

  • DPPL2
  • PPAPDC1A phosphatidic acid phosphatase type 2 domain containing 1A


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, IF
Species: Hu, Pm
Applications: WB, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Species: Hu
Applications: ICC/IF
Species: Hu
Species: Hu
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
Species: Hu, Mu, Rt, Bv, Ca, Ch, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P, IP, PLA
Species: Hu
Applications: WB, ELISA, IHC
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
Species: Hu
Applications: WB, IHC
Species: Mu, Rt
Applications: WB, Simple Western, IHC
Species: Hu, Mu, Rt
Applications: PEP-ELISA
Species: Hu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Op, Pm
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PPAPDC1A Antibody (NBP2-14545)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC-P.

Filter By Application
All Applications
Filter By Species
All Species

Reviews for PPAPDC1A Antibody (NBP2-14545) (0)

There are no reviews for PPAPDC1A Antibody (NBP2-14545). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PPAPDC1A Antibody (NBP2-14545) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional PPAPDC1A Products


Bioinformatics Tool for PPAPDC1A Antibody (NBP2-14545)

Discover related pathways, diseases and genes to PPAPDC1A Antibody (NBP2-14545). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PPAPDC1A Antibody (NBP2-14545)

Discover more about diseases related to PPAPDC1A Antibody (NBP2-14545).

Blogs on PPAPDC1A

There are no specific blogs for PPAPDC1A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PPAPDC1A Antibody and receive a gift card or discount.


Gene Symbol PPAPDC1A