PPAP2C Antibody - BSA Free Summary
| Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of human PPAP2C. Peptide sequence: TVCYISDFFKARPPQHCLKEEELERKPSLSLTLTLGEADHNHYGYPHSSS The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
PLPP2 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for PPAP2C Antibody - BSA Free
Background
PPAP2C, also referred to as Phosphatidic Acid Phosphatase Type 2C, has a canonical sequence that is 288 amino acids long and approximately 32kDa, and two other isoforms that are 309 and 232 amino acids in length, respectively. PPAP2C is an enzyme that hydrolyzes S1P, C1P and LPA, and catalyzes the conversion of phosphatidic acid to diacylglycerol. Current research surrounding PPAP2C has shown a possible linkage with strabismus and gastroenteritis. PPAP2C has also been shown to interact with APLP1, BAG6, GALC, MLH1, and UNC119 in pathways such as triacylglyceride synthesis, sphingolipid metabolism, triacylglycerol biosynthesis, and Fc gamma R-mediated phagocytosis.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: IHC, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, KD, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu, Mu, Rt(-)
Applications: Flow-IC, Flow, ICC/IF, WB
Species: Ch, Fe, Ha, Hu, Mu, Pl, Po, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
Species: Hu, Mu, Rt
Applications: ELISA
Species: Hu
Applications: Flow, ICC/IF, PA
Species: Hu, Mu
Applications: ICC/IF, KD, WB
Publications for PPAP2C Antibody (NBP2-83410) (0)
There are no publications for PPAP2C Antibody (NBP2-83410).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for PPAP2C Antibody (NBP2-83410) (0)
There are no reviews for PPAP2C Antibody (NBP2-83410).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for PPAP2C Antibody (NBP2-83410) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional PPAP2C Products
Blogs on PPAP2C