PPAP2B Recombinant Protein Antigen

Images

 
There are currently no images for PPAP2B Recombinant Protein Antigen (NBP2-57350PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

PPAP2B Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PPAP2B.

Source: E. coli

Amino Acid Sequence: SDLFKTKTTLSLPAPAIRKEILSPVDIIDRNNHHNMM

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PLPP3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57350.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PPAP2B Recombinant Protein Antigen

  • Dri42
  • EC 3.1.3.4
  • lipid phosphate phosphohydrolase 3
  • LPP3PAP2 beta
  • MGC15306
  • PAP2b
  • PAP-2b
  • PAP2-beta
  • Phosphatidate phosphohydrolase type 2b
  • Phosphatidic acid phosphatase 2b
  • phosphatidic acid phosphatase type 2B
  • type-2 phosphatidic acid phosphatase-beta
  • vascular endothelial growth factor and type I collagen inducible
  • Vascular endothelial growth factor and type I collagen-inducible protein
  • VCIP

Background

The protein encoded by the PPAP2B gene is a member of the phosphatidic acid phosphatase (PAP) family. PAPs convert phosphatidic acid to diacylglycerol, and function in de novo synthesis of glycerolipids as well as in receptor-activated signal transduction mediated by phospholipase D. This protein is a membrane glycoprotein localized at the cell plasma membrane. It has been shown to actively hydrolyze extracellular lysophosphatidic acid and short-chain phosphatidic acid. The expression of this gene is found to be enhanced by epidermal growth factor in Hela cells. Alternatively spliced transcript variants encoding the same protein have been described. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45378
Species: Hu
Applications: IHC,  IHC-P, WB
NBP3-05161
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-89549
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF4815
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP1-86990
Species: Hu, Mu
Applications: ICC/IF, KD, WB
NBP2-31607
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-37477
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-45646
Species: Ca, Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-01763
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
H00005555-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP3-46899
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP2-46518
Species: Hu
Applications: IHC,  IHC-P, WB
H00002038-M01
Species: Hu
Applications: ELISA, ICC/IF, WB
DTSP10
Species: Hu
Applications: ELISA
NBP2-02434
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
H00005706-M02
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, KD, WB
AF4467
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NBP2-00532
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
H00001434-M08
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-57350PEP
Species: Hu
Applications: AC

Publications for PPAP2B Recombinant Protein Antigen (NBP2-57350PEP) (0)

There are no publications for PPAP2B Recombinant Protein Antigen (NBP2-57350PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PPAP2B Recombinant Protein Antigen (NBP2-57350PEP) (0)

There are no reviews for PPAP2B Recombinant Protein Antigen (NBP2-57350PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PPAP2B Recombinant Protein Antigen (NBP2-57350PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PPAP2B Products

Research Areas for PPAP2B Recombinant Protein Antigen (NBP2-57350PEP)

Find related products by research area.

Blogs on PPAP2B

There are no specific blogs for PPAP2B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PPAP2B Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PLPP3