PP2C gamma/PPM1G Recombinant Protein Antigen

Images

 
There are currently no images for PP2C gamma/PPM1G Protein (NBP1-87246PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

PP2C gamma/PPM1G Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PPM1G.

Source: E.coli

Amino Acid Sequence: NGELRLLSSIVEELLDQCLAPDTSGDGTGCDNMTCIIICFKPRNTAELQPESGKRKLEEVLSTEGAEENGNSD

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PPM1G
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-87246.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for PP2C gamma/PPM1G Recombinant Protein Antigen

  • EC 3.1.3.16
  • MGC1675
  • MGC2870
  • PP2C gamma
  • PP2C, gamma
  • PP2CG
  • PP2CGAMMA
  • PP2C-gamma
  • PPM1C
  • PPM1G
  • PPP2CG
  • Protein phosphatase 1C
  • protein phosphatase 1G (formerly 2C), magnesium-dependent, gamma isoform
  • protein phosphatase 1G
  • protein phosphatase 2, catalytic subunit, gamma isoform
  • protein phosphatase 2C gamma isoform
  • Protein phosphatase 2C isoform gamma
  • Protein phosphatase magnesium-dependent 1 gamma
  • protein phosphatase, Mg2+/Mn2+ dependent, 1G

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-31348
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32858
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-24740
Species: Hu, Mu, Bv, Ca, Eq, Pm
Applications: WB, IHC, IHC-P
NB100-1793
Species: Hu, Mu, Mk
Applications: IB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP1-97572
Species: Hu, Mu, Rt, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP, In vivo
NBP2-37530
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NB100-41403
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
H00055599-P01
Species: Hu
NBP2-14871
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB100-513
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP2-67413
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-98474
Species: Hu
Applications: WB
NBP1-76963
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ELISA, IHC, IHC-P, IF
NBP2-15939
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-74457
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NLS3898
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-52454
Species: Hu, Rt
Applications: WB, ELISA, Flow, ICC/IF, CyTOF-ready

Publications for PP2C gamma/PPM1G Protein (NBP1-87246PEP) (0)

There are no publications for PP2C gamma/PPM1G Protein (NBP1-87246PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PP2C gamma/PPM1G Protein (NBP1-87246PEP) (0)

There are no reviews for PP2C gamma/PPM1G Protein (NBP1-87246PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PP2C gamma/PPM1G Protein (NBP1-87246PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional PP2C gamma/PPM1G Products

Bioinformatics Tool for PP2C gamma/PPM1G Protein (NBP1-87246PEP)

Discover related pathways, diseases and genes to PP2C gamma/PPM1G Protein (NBP1-87246PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PP2C gamma/PPM1G Protein (NBP1-87246PEP)

Discover more about diseases related to PP2C gamma/PPM1G Protein (NBP1-87246PEP).
 

Pathways for PP2C gamma/PPM1G Protein (NBP1-87246PEP)

View related products by pathway.

PTMs for PP2C gamma/PPM1G Protein (NBP1-87246PEP)

Learn more about PTMs related to PP2C gamma/PPM1G Protein (NBP1-87246PEP).
 

Research Areas for PP2C gamma/PPM1G Protein (NBP1-87246PEP)

Find related products by research area.

Blogs on PP2C gamma/PPM1G

There are no specific blogs for PP2C gamma/PPM1G, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

USP7 Antibody
NB100-513

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PP2C gamma/PPM1G Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PPM1G
COVID-19 update