PP2C gamma/PPM1G Recombinant Protein Antigen

Images

 
There are currently no images for PP2C gamma/PPM1G Protein (NBP1-87245PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

PP2C gamma/PPM1G Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PPM1G.

Source: E. coli

Amino Acid Sequence: LYCAKYLPDIIKDQKAYKEGKLQKALEDAFLAIDAKLTTEEVIKELAQIAGRPTEDEDEKEKVADEDDVD

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PPM1G
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87245.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PP2C gamma/PPM1G Recombinant Protein Antigen

  • EC 3.1.3.16
  • MGC1675
  • MGC2870
  • PP2C gamma
  • PP2C, gamma
  • PP2CG
  • PP2CGAMMA
  • PP2C-gamma
  • PPM1C
  • PPM1G
  • PPP2CG
  • Protein phosphatase 1C
  • protein phosphatase 1G (formerly 2C), magnesium-dependent, gamma isoform
  • protein phosphatase 1G
  • protein phosphatase 2, catalytic subunit, gamma isoform
  • protein phosphatase 2C gamma isoform
  • Protein phosphatase 2C isoform gamma
  • Protein phosphatase magnesium-dependent 1 gamma
  • protein phosphatase, Mg2+/Mn2+ dependent, 1G

Background

PPM1G is encoded by this gene is a member of the PP2C family of Ser/Thr protein phosphatases. PP2C family members are known to be negative regulators of cell stress response pathways. This phosphatase is found to be responsible for the dephosphorylation of Pre-mRNA splicing factors, which is important for the formation of functional spliceosome. Studies of a similar gene in mice suggested a role of this phosphatase in regulating cell cycle progression. Alternatively spliced transcript variants encoding the same protein have been described.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-31348
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-32858
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP2-20521
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KO, WB
NB100-1793
Species: Hu, Pm, Mu, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, PEP-ELISA
NBP1-89945
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP1-87232
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-41403
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, PEP-ELISA, WB
NBP2-57100
Species: Hu
Applications: ICC/IF
NBP2-14871
Species: Mu, Rt
Applications: ICC/IF, WB
NB100-513
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NB120-2860
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-15669
Species: Mu, Rt, Ze
Applications: IHC-WhMt, IHC, WB
NBP1-76963
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP2-15939
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NB100-74457
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NLS3890
Species: Bv, Hu, Pm, Pm
Applications: IHC,  IHC-P
NBP2-52454
Species: Hu, Rt
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, WB

Publications for PP2C gamma/PPM1G Protein (NBP1-87245PEP) (0)

There are no publications for PP2C gamma/PPM1G Protein (NBP1-87245PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PP2C gamma/PPM1G Protein (NBP1-87245PEP) (0)

There are no reviews for PP2C gamma/PPM1G Protein (NBP1-87245PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PP2C gamma/PPM1G Protein (NBP1-87245PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PP2C gamma/PPM1G Products

Research Areas for PP2C gamma/PPM1G Protein (NBP1-87245PEP)

Find related products by research area.

Blogs on PP2C gamma/PPM1G

There are no specific blogs for PP2C gamma/PPM1G, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PP2C gamma/PPM1G Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PPM1G