PP2A alpha Recombinant Protein Antigen

Images

 
There are currently no images for PP2A alpha Recombinant Protein Antigen (NBP2-46693PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

PP2A alpha Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PPP2CA.

Source: E. coli

Amino Acid Sequence: RCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYF

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PPP2CA
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-46693.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PP2A alpha Recombinant Protein Antigen

  • EC 3.1.3.16
  • PP2A
  • PP2A-alpha
  • PP2Ac
  • PP2CA
  • PP2Calpha
  • PPP2CA
  • protein phosphatase 2 (formerly 2A), catalytic subunit, alpha isoform
  • protein phosphatase 2, catalytic subunit, alpha isozyme
  • protein phosphatase 2A catalytic subunit, alpha isoform
  • Replication protein C
  • RP-C
  • serine/threonine protein phosphatase 2A, catalytic subunit, alpha isoform
  • serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform

Background

Protein phosphatase type 2A (PP2A ) is a protein serine/threonine phosphatase that controls fundamental cellular processes, including transcription, translation, metabolism, cell growth, apoptosis, and varied other signal transduction pathways. PP2A is comprised of a core enzyme (which is made up of catalytic C and regulatory A (PR65) subunits) and a secondary regulatory B subunit. PP2A alpha refers to the alpha isoform of the PP2A catalytic subunit.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB500-106
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
AF6457
Species: Hu
Applications: WB
NBP1-59904
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-67563
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
NBP3-13066
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP1-87232
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-45570
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
NBP2-45946
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-31348
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-89342
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NBP2-24457
Species: Hu, Mu, Pm
Applications: IHC,  IHC-P, WB
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
AF800
Species: Hu, Mu
Applications: IP, Simple Western, WB
NBP1-03346
Species: Hu
Applications: IHC,  IHC-P, IP, WB
NBP1-82668
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB

Publications for PP2A alpha Recombinant Protein Antigen (NBP2-46693PEP) (0)

There are no publications for PP2A alpha Recombinant Protein Antigen (NBP2-46693PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PP2A alpha Recombinant Protein Antigen (NBP2-46693PEP) (0)

There are no reviews for PP2A alpha Recombinant Protein Antigen (NBP2-46693PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PP2A alpha Recombinant Protein Antigen (NBP2-46693PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PP2A alpha Products

Research Areas for PP2A alpha Recombinant Protein Antigen (NBP2-46693PEP)

Find related products by research area.

Blogs on PP2A alpha

There are no specific blogs for PP2A alpha, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PP2A alpha Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PPP2CA