Recombinant Human POU5F2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human POU5F2 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 2 - 100 of Human FLJ25680 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:AGHRPSNHFCPLPGSGGGGPRGPMPLRVDTLTWLSTQAAPGRVMVWPAVRPGICPGPDVWRIPLGPLPHEFRGWIAPCRPRLGASEAGDWLRRPSEGAL

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
POU5F2
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human POU5F2 Protein

  • DKFZp686P02123
  • FLJ25680
  • POU domain class 5, transcription factor 2
  • Sperm 1 POU domain transcription factor
  • SPRM1
  • SPRM-1POU domain, class 5, transcription factor 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-36491
Species: Hu
Applications: WB, Flow, IHC, IHC-P, Flow-CS
NBP2-50465
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Flow-CS
AF1759
Species: Hu, Mu
Applications: WB, Simple Western, IP, ChIP, ICC
27570002
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
H00005452-D01P
Species: Hu, Mu, Rt
Applications: WB
NBP2-21584
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-92273
Species: Hu
Applications: IHC, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
MAB1774
Species: Hu
Applications: Flow, CyTOF-ready, ICC
NBP1-76701
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP1-83966
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-13791
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89934
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-49872
Species: Mu, Rt
Applications: WB, PEP-ELISA
NBP2-61436
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC-P
NBP1-31470
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P

Publications for POU5F2 Partial Recombinant Protein (H00134187-Q01) (0)

There are no publications for POU5F2 Partial Recombinant Protein (H00134187-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for POU5F2 Partial Recombinant Protein (H00134187-Q01) (0)

There are no reviews for POU5F2 Partial Recombinant Protein (H00134187-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for POU5F2 Partial Recombinant Protein (H00134187-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional POU5F2 Products

Bioinformatics Tool for POU5F2 Partial Recombinant Protein (H00134187-Q01)

Discover related pathways, diseases and genes to POU5F2 Partial Recombinant Protein (H00134187-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on POU5F2

There are no specific blogs for POU5F2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

OCT4 Antibody
NB100-2379

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human POU5F2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol POU5F2