POU2F3 Antibody - BSA Free

Western Blot: POU2F3 Antibody [NBP2-88076] - Host: Rabbit. Target Name: POU2F3. Sample Type: Fetal Kidney lysates. Antibody Dilution: 1.0ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

POU2F3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit POU2F3 Antibody - BSA Free (NBP2-88076) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human POU2F3. Peptide sequence: LSVPPVHSTMPGTVTSSCSPGNNSRPSSPGSGLHASSPTASQNNSKAAVN The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: POU2F3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for POU2F3 Antibody - BSA Free

• Epoc-1
• MGC126698
• OCT11
• OCT-11
• OCT11FLJ40063
• Octamer-binding protein 11
• Octamer-binding transcription factor 11
• OTF11
• OTF-11
• PLA1
• PLA-1
• POU class 2 homeobox 3
• POU domain class 2, transcription factor 3
• POU domain, class 2, transcription factor 3
• POU transcription factor
• POU2F3
• Skn-1a
• Transcription factor PLA-1
• Transcription factor Skn-1

Background

POU2F3, also referred to as POU domain, class 2, transcription factor 3, is a transcription factor that belongs to the POU protein family. POU2F3 has a 436 amino acid long isoform, a 438 amino acid long isoform, and a 432 amino acid long isoform, all three of which are approximately 47kDa. POU2F3 is highly expressed in keratinocytes and the epidermis. Current research surrounding POU2F3 has shown possible interactions with diseases and disorders such as atherosclerosis, bipolar disorder, herpes, cervical cancer, breast cancer, and neuroendocrine tumors. POU2F3 has also been shown to interact with Bcl6, Ubiquitin and KAT3A/CBP.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: POU2F3