POLR2J Recombinant Protein Antigen

Images

 
There are currently no images for POLR2J Recombinant Protein Antigen (NBP2-46697PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

POLR2J Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human POLR2J.

Source: E.coli

Amino Acid Sequence: DPQVLFAGYKVPHPLEHKIIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFR

Protein/Peptide Type
Recombinant Protein Antigen
Gene
POLR2J
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-46697. Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed. For further blocking peptide related information and a protocol, click here.
Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for POLR2J Recombinant Protein Antigen

  • DNA-directed RNA polymerase II subunit J-1
  • DNA-directed RNA polymerase II subunit RPB11-a
  • hRPB14
  • MGC71910
  • POLR2J1RNA polymerase II subunit B11-a
  • polymerase (RNA) II (DNA directed) polypeptide J (13.3kD)
  • polymerase (RNA) II (DNA directed) polypeptide J, 13.3kDa
  • RNA polymerase II 13.3 kDa subunit
  • RPB11
  • RPB11A
  • RPB11m

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-19885
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87786
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-598
Species: Hu, Mu, Ye, Pm(-)
Applications: WB, ChIP, ELISA, Flow, ICC/IF, IP, CyTOF-ready, Flow-IC
NBP2-00482
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, IHC, IHC-P
NBP1-80816
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-82655
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00009533-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB120-14254
Species: Hu, Mu
Applications: WB, IHC
NBP2-47329
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-55856
Species: Hu
Applications: ICC/IF
NBP2-03649
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-92344
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89727
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NBP1-83552
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-57160
Species: Hu
Applications: WB, IHC, IHC-P, KD
NBP1-22439
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-46697PEP
Species: Hu
Applications: AC

Publications for POLR2J Recombinant Protein Antigen (NBP2-46697PEP) (0)

There are no publications for POLR2J Recombinant Protein Antigen (NBP2-46697PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for POLR2J Recombinant Protein Antigen (NBP2-46697PEP) (0)

There are no reviews for POLR2J Recombinant Protein Antigen (NBP2-46697PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for POLR2J Recombinant Protein Antigen (NBP2-46697PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for POLR2J Recombinant Protein Antigen (NBP2-46697PEP)

Discover related pathways, diseases and genes to POLR2J Recombinant Protein Antigen (NBP2-46697PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for POLR2J Recombinant Protein Antigen (NBP2-46697PEP)

Discover more about diseases related to POLR2J Recombinant Protein Antigen (NBP2-46697PEP).
 

Pathways for POLR2J Recombinant Protein Antigen (NBP2-46697PEP)

View related products by pathway.

PTMs for POLR2J Recombinant Protein Antigen (NBP2-46697PEP)

Learn more about PTMs related to POLR2J Recombinant Protein Antigen (NBP2-46697PEP).

Blogs on POLR2J

There are no specific blogs for POLR2J, but you can read our latest blog posts.

Customers Who Bought This Also Bought

POLR2J Antibody
NBP2-46733

Contact Information

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our POLR2J Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol POLR2J