POLE4 Recombinant Protein Antigen (NBP2-54947PEP)

Images

 
There are currently no images for POLE4 Recombinant Protein Antigen (NBP2-54947PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

POLE4 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human POLE4.

Source: E.coli

Amino Acid Sequence: VPGARLSRLPLARVKALVKADPDVTLAGQEAIFILARAAELFVETIAKDAYCCAQQGKRKTLQRRDLDNAIEAVDEFAFLEGTL

Protein/Peptide Type
Recombinant Protein Antigen
Gene
POLE4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-54947 The protein was purified by IMAC chromatography and the expected concentration is greater than 0.5 mg/ml. This protein is produced on demand, estimated shipping date is 4 weeks after the order is placed. For further blocking peptide related protocol, click here.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for POLE4 Recombinant Protein Antigen

  • DNA polymerase epsilon p12 subunit
  • DNA polymerase epsilon subunit 4
  • DNA polymerase epsilon subunit p12
  • DNA polymerase II subunit 4
  • EC 2.7.7.7
  • p12
  • polymerase (DNA-directed), epsilon 4 (p12 subunit)
  • YHHQ1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-82454
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF2377
Species: Mu
Applications: WB, Simple Western, IHC
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
H00029107-M08
Species: Hu
Applications: WB, ELISA, ICC/IF
MAB6798
Species: Hu
Applications: WB, ICC
NBP1-82805
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22261
Species: Hu, Mu, Ch
Applications: WB, IP
NBP1-71702
Species: Hu, Mu, Ch
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-P, IP
NBP2-13785
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84545
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86784
Species: Hu
Applications: IHC, IHC-P
NBP1-92355
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-82458
Species: Hu
Applications: IHC, IHC-P
NBP1-57508
Species: Hu
Applications: WB, IHC, IHC-P
AF2065
Species: Mu
Applications: WB, Simple Western, ICC
NBP1-87431
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-71687
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-80965
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for POLE4 Recombinant Protein Antigen (NBP2-54947PEP) (0)

There are no publications for POLE4 Recombinant Protein Antigen (NBP2-54947PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for POLE4 Recombinant Protein Antigen (NBP2-54947PEP) (0)

There are no reviews for POLE4 Recombinant Protein Antigen (NBP2-54947PEP). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

FAQs for POLE4 Recombinant Protein Antigen (NBP2-54947PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional POLE4 Products

Related Products by Gene

Bioinformatics Tool for POLE4 Recombinant Protein Antigen (NBP2-54947PEP)

Discover related pathways, diseases and genes to POLE4 Recombinant Protein Antigen (NBP2-54947PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for POLE4 Recombinant Protein Antigen (NBP2-54947PEP)

Discover more about diseases related to POLE4 Recombinant Protein Antigen (NBP2-54947PEP).
 

Pathways for POLE4 Recombinant Protein Antigen (NBP2-54947PEP)

View related products by pathway.

PTMs for POLE4 Recombinant Protein Antigen (NBP2-54947PEP)

Learn more about PTMs related to POLE4 Recombinant Protein Antigen (NBP2-54947PEP).
 

Research Areas for POLE4 Recombinant Protein Antigen (NBP2-54947PEP)

Find related products by research area.

Blogs on POLE4

There are no specific blogs for POLE4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

p19ARF Antibody
NB200-106
p19ARF Antibody
NB200-106
p19ARF Antibody
NB200-106
POLE4 Antibody
NBP2-49672

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our POLE4 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol POLE4