POLD4 Antibody (2B11)


ELISA: POLD4 Antibody (2B11) [H00057804-M01A] - Detection limit for recombinant GST tagged POLD4 is approximately 0.3ng/ml as a capture antibody.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ELISA

Order Details

POLD4 Antibody (2B11) Summary

POLD4 (AAH01334, 1 a.a. ~ 34 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MGRKRLITDSYPVVKRREGPAGHSKGELAPELGL
POLD4 (2B11)
IgG2b Kappa
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • ELISA 1:100-1:2000
  • Western Blot 1:500
Application Notes
Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Read Publications using H00057804-M01A.

Packaging, Storage & Formulations

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
No Preservative


This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for POLD4 Antibody (2B11)

  • DNA polymerase delta smallest subunit p12
  • DNA polymerase delta subunit p12
  • p12
  • POLDSDNA polymerase delta subunit 4
  • polymerase (DNA-directed), delta 4


The DNA polymerase delta complex is involved in DNA replication and repair, and it consists of the proliferating cell nuclear antigen (PCNA; MIM 176740), the multisubunit replication factor C (see MIM 102579), and the 4 subunit polymerase complex: POLD1 (MIM 174761), POLD2 (MIM 600815), POLD3 (MIM 611415), and POLD4 (Liu and Warbrick, 2006 [PubMed 16934752]).[supplied by OMIM]


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: IHC, Simple Western, WB
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
Species: Hu
Applications: ELISA, ICC/IF, KD, S-ELISA, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IP, WB
Species: Ch, Hu, Mu
Applications: IP, WB
Species: Ch, Hu, Mu
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PA
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: WB
Species: Hu
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P, WB
Species: Mu
Applications: ICC, IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB

Publications for POLD4 Antibody (H00057804-M01A)(5)

Reviews for POLD4 Antibody (H00057804-M01A) (0)

There are no reviews for POLD4 Antibody (H00057804-M01A). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for POLD4 Antibody (H00057804-M01A) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional POLD4 Products

Bioinformatics Tool for POLD4 Antibody (H00057804-M01A)

Discover related pathways, diseases and genes to POLD4 Antibody (H00057804-M01A). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for POLD4 Antibody (H00057804-M01A)

Discover more about diseases related to POLD4 Antibody (H00057804-M01A).

Pathways for POLD4 Antibody (H00057804-M01A)

View related products by pathway.

PTMs for POLD4 Antibody (H00057804-M01A)

Learn more about PTMs related to POLD4 Antibody (H00057804-M01A).

Research Areas for POLD4 Antibody (H00057804-M01A)

Find related products by research area.

Blogs on POLD4

There are no specific blogs for POLD4, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our POLD4 Antibody (2B11) and receive a gift card or discount.


Gene Symbol POLD4