POLD4 Antibody (2B11)

ELISA: POLD4 Antibody (2B11) [H00057804-M01A] - Detection limit for recombinant GST tagged POLD4 is approximately 0.3ng/ml as a capture antibody.

Product Discontinued

POLD4 Antibody (2B11) Summary

• Immunogen: POLD4 (AAH01334, 1 a.a. ~ 34 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MGRKRLITDSYPVVKRREGPAGHSKGELAPELGL
• Specificity: POLD4 (2B11)
• Isotype: IgG2b Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: POLD4
• Purity: Unpurified

Applications/Dilutions

• Dilutions:
  • ELISA 1:100-1:2000
  • Western Blot 1:500
• Application Notes: Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: Ascites
• Preservative: No Preservative
• Purity: Unpurified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for POLD4 Antibody (2B11)

• DNA polymerase delta smallest subunit p12
• DNA polymerase delta subunit p12
• p12
• POLDSDNA polymerase delta subunit 4
• polymerase (DNA-directed), delta 4

Background

The DNA polymerase delta complex is involved in DNA replication and repair, and it consists of the proliferating cell nuclear antigen (PCNA; MIM 176740), the multisubunit replication factor C (see MIM 102579), and the 4 subunit polymerase complex: POLD1 (MIM 174761), POLD2 (MIM 600815), POLD3 (MIM 611415), and POLD4 (Liu and Warbrick, 2006 [PubMed 16934752]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for POLD4 Antibody (H00057804-M01A)(5)

Publications using H00057804-M01A

• Zhang JM, Yadav T, Ouyang J et al. Alternative Lengthening of Telomeres through Two Distinct Break-Induced Replication Pathways. Cell Rep 2019-01-22 [PMID: 30673617] (Human)
• Minocherhomji S, Ying S, Bjerregaard VA et al. Replication stress activates DNA repair synthesis in mitosis. Nature 2015-12-02 [PMID: 26633632]
• Huang QM, Tomida S, Masuda Y et al. Regulation of DNA polymerase POLD4 influences genomic instability in lung cancer. Cancer Res 2010-11-01 [PMID: 20861182]
• Huang QM, Akashi T, Masuda Y et al. Roles of POLD4, smallest subunit of DNA polymerase delta, in nuclear structures and genomic stability of human cells. Biochem Biophys Res Commun. 2009-11-24 [PMID: 19931513]
• Zhang S, Zhou Y, Trusa S et al. A novel DNA damage response: Rapid degradation of the p12 subunit of DNA polymerase delta. J Biol Chem;282(21):15330-40. 2007-05-25 [PMID: 17317665]

Bioinformatics

• Gene Symbol: POLD4
• Entrez:
  • 57804(Human)
• Uniprot:
  • AAH01334(Human)